Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5319
Gene name Gene Name - the full gene name approved by the HGNC.	Phospholipase A2 group IB
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLA2G1B
Synonyms (NCBI Gene) Gene synonyms aliases	PLA2, PLA2A, PPLA2
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to r

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0002446	Process	Neutrophil mediated immunity	ISS	16005851
GO:0004623	Function	Phospholipase A2 activity	IDA	1918029
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	ISS	15528384
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IDA	1918029
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	7721806
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	7060561
GO:0005509	Function	Calcium ion binding	IEA
GO:0005543	Function	Phospholipid binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	7060561, 12860195
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IDA	1918029
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0007015	Process	Actin filament organization	TAS	9886417
GO:0007165	Process	Signal transduction	TAS	9886417
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	1918029
GO:0009986	Component	Cell surface	IDA	1918029
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	ISS	15528384
GO:0016042	Process	Lipid catabolic process	IDA	7060561
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	ISS	16005851
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0030593	Process	Neutrophil chemotaxis	ISS	16005851
GO:0032052	Function	Bile acid binding	ISS	7060561
GO:0032757	Process	Positive regulation of interleukin-8 production	ISS	15528384
GO:0032869	Process	Cellular response to insulin stimulus	ISS	1918029
GO:0035556	Process	Intracellular signal transduction	ISS	15528384
GO:0043410	Process	Positive regulation of MAPK cascade	ISS	15528384
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	15528384
GO:0046324	Process	Regulation of D-glucose import	ISS	1918029
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	7060561, 17603006
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IBA
GO:0046471	Process	Phosphatidylglycerol metabolic process	IDA	1420353
GO:0046872	Function	Metal ion binding	IEA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IBA
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	1420353, 7060561, 17603006
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	1918029
GO:0050482	Process	Arachidonate secretion	IEA
GO:0050482	Process	Arachidonate secretion	TAS	12423354
GO:0050714	Process	Positive regulation of protein secretion	TAS	17981679
GO:0050778	Process	Positive regulation of immune response	ISS	16005851
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195
GO:1904635	Process	Positive regulation of podocyte apoptotic process	IDA	25335547

MIM	HGNC	e!Ensembl
172410	9030	ENSG00000170890

Protein

UniProt ID

P04054

Protein name

Phospholipase A2 (EC 3.1.1.4) (Group IB phospholipase A2) (Phosphatidylcholine 2-acylhydrolase 1B)

Protein function

Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract (PubMed:10681567, PubMed:1420353, PubMed:17603006). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of

PDB

3ELO , 6Q42

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00068	Phospholip_A2_1	24 → 138	Phospholipase A2	Domain

Tissue specificity

TISSUE SPECIFICITY: Selectively expressed in pancreas, lung, liver and kidney. Also detected at lower levels in ovary and testis. {ECO:0000269|PubMed:10681567}.

Sequence

MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS

Sequence length

148

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Ether lipid metabolism Arachidonic acid metabolism Linoleic acid metabolism alpha-Linolenic acid metabolism Metabolic pathways Ras signaling pathway Vascular smooth muscle contraction Pancreatic secretion Fat digestion and absorption		Acyl chain remodelling of PC Acyl chain remodelling of PS Acyl chain remodelling of PE Acyl chain remodelling of PI Acyl chain remodelling of PG Synthesis of PA

PLA2G1B (phospholipase A2 group IB)