Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5318
Gene name Gene Name - the full gene name approved by the HGNC.
Plakophilin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PKP2
Synonyms (NCBI Gene) Gene synonyms aliases
ARVD9
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs78897684 C>A,G Pathogenic Splice acceptor variant
rs111517471 C>A,G,T Likely-pathogenic, pathogenic Splice donor variant
rs121434420 G>A Pathogenic Coding sequence variant, stop gained
rs121434421 G>A,C Pathogenic Coding sequence variant, stop gained, missense variant
rs139139859 T>C Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025489 hsa-miR-34a-5p Proteomics 21566225
MIRT046783 hsa-miR-222-3p CLASH 23622248
MIRT044957 hsa-miR-186-5p CLASH 23622248
MIRT037616 hsa-miR-744-5p CLASH 23622248
MIRT1238069 hsa-miR-1255a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001533 Component Cornified envelope TAS
GO:0002159 Process Desmosome assembly IMP 18474624
GO:0002934 Process Desmosome organization IBA
GO:0003677 Function DNA binding IDA 20613778
GO:0005080 Function Protein kinase C binding IPI 18474624
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602861 9024 ENSG00000057294
Protein
UniProt ID Q99959
Protein name Plakophilin-2
Protein function A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (PubMed:25208567). Regulates focal adhesion turnover resulting in changes in focal adhesion size, cell adhesion and cell spreading, pote
PDB 3TT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00514 Arm 384 424 Armadillo/beta-catenin-like repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed at intercalated disks in the heart (at protein level) (PubMed:18662195). Expressed in gingival epithelial, endothelial and fibroblast cells (at protein level) (PubMed:34368962). Faintly expressed in tracheal epithelial cells
Sequence
MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQV
QQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYE
GRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHH
QESRRAALLVPPRYARSEIVGVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPAL
LTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRT
LREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADMEMTLERAVSML
EADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALR
NLVF
EDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITDHTVNLRSRNGWPGAVAHACN
PSTLGGQGGRITRSGVRDQPDQHGLLWNLSSNDKLKNLMITEALLTLTENIIIPFSGWPE
GDYPKANGLLDFDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPD
DKATENCVCILHNLSYQLEAELPEKYSQNIYIQNRNIQTDNNKSIGCFGSRSRKVKEQYQ
DVPMPEEKSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGSGPMPTSV
AQTVVQKESGLQHTRKMLHVGDPSVKKTAISLLRNLSRNLSLQNEIAKETLPDLVSIIPD
TVPSTDLLIETTASACYTLNNIIQNSYQNARDLLNTGGIQKIMAISAGDAYASNKASKAA
SVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD
Sequence length 881
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytoskeleton in muscle cells
Arrhythmogenic right ventricular cardiomyopathy
  Keratinization
Formation of the cornified envelope
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular dysplasia 9, Familial isolated arrhythmogenic right ventricular dysplasia rs1318070848, rs1555142994, rs794729126, rs754912778, rs1555142984, rs1064792929, rs397516997, rs769220833, rs794729129, rs111517471, rs1956192035, rs727504432, rs1353074803, rs794729107, rs397516987
View all (85 more)
N/A
arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy rs958681660, rs397517008, rs397516987, rs397517013, rs193922672, rs786204388, rs1555142994, rs794729126, rs754912778, rs397516997, rs1565574709, rs397517025, rs1555148032, rs397517009, rs869025496
View all (54 more)
N/A
cardiomyopathy Cardiomyopathy rs727504432, rs786204388, rs794729120, rs397516992, rs794729116, rs1064794350, rs1565590309, rs397517008, rs1555142963, rs769220833, rs1956192035, rs397516997, rs193922672, rs1555144459, rs397516993
View all (31 more)
N/A
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy rs1956121988 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Becker Muscular Dystrophy becker muscular dystrophy N/A N/A ClinVar
Brugada Syndrome brugada syndrome, Brugada syndrome 1 N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abrikosov's tumor Inhibit 28323918
Adenocarcinoma Associate 35109912
Adenocarcinoma of Lung Associate 35403268
Arrhythmias Cardiac Associate 22035158, 23651034, 30790397
Arrhythmogenic Right Ventricular Dysplasia Associate 16415378, 16698823, 16799251, 17010805, 17033975, 17041889, 18596851, 19084810, 19358943, 19533476, 20031617, 20124997, 20152563, 21636032, 21822014
View all (64 more)
Arrhythmogenic Right Ventricular Dysplasia Inhibit 26590176, 35628349
Arrhythmogenic Right Ventricular Dysplasia Familial 9 Associate 21908389, 39332132
Atrial Fibrillation Associate 30061737, 31539150, 36669898
Atrioventricular Block Associate 36352534
Brugada Syndrome Associate 32443836