Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5311
Gene name Gene Name - the full gene name approved by the HGNC.
Polycystin 2, transient receptor potential cation channel
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PKD2
Synonyms (NCBI Gene) Gene synonyms aliases
APKD2, PC2, PKD4, Pc-2, TRPP2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. T
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs58606740 G>A Pathogenic Splice donor variant
rs121918039 G>A Pathogenic Stop gained, coding sequence variant, non coding transcript variant, intron variant
rs121918040 C>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant
rs121918041 C>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant, intron variant
rs121918042 C>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001158 hsa-miR-17-5p Luciferase reporter assay, qRT-PCR, Western blot 19821056
MIRT001158 hsa-miR-17-5p Luciferase reporter assay, qRT-PCR, Western blot 19821056
MIRT001158 hsa-miR-17-5p Luciferase reporter assay, qRT-PCR, Western blot 19821056
MIRT001158 hsa-miR-17-5p Luciferase reporter assay 19821056
MIRT020485 hsa-miR-106b-5p Western blot 20709030
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001658 Process Branching involved in ureteric bud morphogenesis IEP 11891195
GO:0001822 Process Kidney development IEA
GO:0001822 Process Kidney development IEA
GO:0001889 Process Liver development IEA
GO:0001889 Process Liver development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
173910 9009 ENSG00000118762
Protein
UniProt ID Q13563
Protein name Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2)
Protein function Forms a nonselective cation channel (PubMed:11854751, PubMed:11991947, PubMed:15692563, PubMed:26269590, PubMed:27071085, PubMed:31441214, PubMed:39009345). Can function as a homotetrameric ion channel or can form heteromer with PKD1 (PubMed:314
PDB 2KLD , 2KLE , 2KQ6 , 2Y4Q , 3HRN , 3HRO , 5K47 , 5MKE , 5MKF , 5T4D , 6A70 , 6D1W , 6T9N , 6T9O , 6WB8 , 8HK7 , 8K3S , 9DLI , 9DWQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08016 PKD_channel 267 687 Polycystin cation channel Family
PF18109 Fer4_24 834 868 Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal and adult kidney (PubMed:10770959). Detected at the thick ascending limb of the loop of Henle, at distal tubules, including the distal convoluted tubule and cortical collecting tubules, with weak staining of the colle
Sequence
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIR
QAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRP
GSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL
EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYG
MMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQ
TEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR
ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIF
CFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE
DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGF
AIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIY
FTTFVFFMFFILLNMFLAIINDTYSEV
KSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN
TVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRD
DLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ
VLVRRVDRMEHSIGSIVSKIDAVIVKLE
IMERAKLKRREVLGRLLDGVAEDERLGRDSEI
HREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGG
NGSSNVHV
Sequence length 968
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    VxPx cargo-targeting to cilium
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Polycystic kidney disease autosomal dominant polycystic kidney disease, Polycystic kidney disease 2, autosomal recessive polycystic kidney disease rs398123308, rs886041114, rs752024467, rs1553924174, rs1726245372, rs1560608729, rs1578135829, rs145877597, rs369678636, rs1553928730, rs58606740, rs1578144873, rs555242193, rs1553927783, rs1553926905
View all (70 more)
N/A
polycystic kidney disease Polycystic kidney disease rs1553926929, rs1553926905, rs121918042, rs1355372474, rs58606740, rs1057518906, rs757757289, rs1302726543, rs749004212, rs755226061, rs1578130676, rs1131692280, rs1324209174, rs1057518797, rs1553927436
View all (9 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hyperuricemia Hyperuricemia N/A N/A GWAS
Joubert Syndrome joubert syndrome 7 N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Renal Tubular Associate 10207066
Adenocarcinoma of Lung Stimulate 30718593
Alzheimer Disease Associate 32967721
Ameloblastoma Stimulate 36857877
Anophthalmia with pulmonary hypoplasia Associate 24847910
Anti N Methyl D Aspartate Receptor Encephalitis Associate 33881537
Aortic Dissection Associate 29378535
Atherosclerosis Associate 19520973, 26286632
Atrial Fibrillation Associate 28839241
Attention Deficit Disorder with Hyperactivity Associate 32967721