Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5307
Gene name Gene Name - the full gene name approved by the HGNC.
Paired like homeodomain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PITX1
Synonyms (NCBI Gene) Gene synonyms aliases
BFT, CCF, LBNBG, POTX, PTX1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CCF, LBNBG
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs370433085 G>A,C Likely-pathogenic Coding sequence variant, synonymous variant, stop gained
rs730882191 GCCGTACGGGCAAGCGCCCGGCGACATGGCCGAGT>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049789 hsa-miR-92a-3p CLASH 23622248
MIRT045636 hsa-miR-149-5p CLASH 23622248
MIRT044749 hsa-miR-320a CLASH 23622248
MIRT043542 hsa-miR-331-3p CLASH 23622248
MIRT614517 hsa-miR-431-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001085 Function RNA polymerase II transcription factor binding IPI 26612202
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602149 9004 ENSG00000069011
Protein
UniProt ID P78337
Protein name Pituitary homeobox 1 (Hindlimb-expressed homeobox protein backfoot) (Homeobox protein PITX1) (Paired-like homeodomain transcription factor 1)
Protein function Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 90 146 Homeodomain Domain
PF03826 OAR 276 293 OAR motif Motif
Sequence
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKER
GGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE
EIAVWTNLTEPRVRVWFKNRRAKWRK
RERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYS
YNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS
GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL
QGPASGLNACQYNS
Sequence length 314
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
18053270
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Clubfoot Familial clubfoot due to PITX1 point mutation, Familial clubfoot due to 5q31 microdeletion rs121909109, rs730882191
Macrocephaly Macrocephaly rs786204854, rs764333096, rs1557739557
Unknown
Disease term Disease name Evidence References Source
Brachydactyly-elbow wrist dysplasia syndrome Brachydactyly-elbow wrist dysplasia syndrome ClinVar
Brachydactyly-Elbow Wrist Dysplasia Syndrome brachydactyly-elbow wrist dysplasia syndrome GenCC
Ulcerative colitis Ulcerative colitis GWAS
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Associations from Text Mining
Disease Name Relationship Type References
Absence of Tibia Associate 18950742, 22258522
Adamantinoma Associate 22258522
Adenocarcinoma of Lung Associate 32294625, 33530195
Adenoma Associate 18079591
Autistic Disorder Associate 18053270
Breast Neoplasms Associate 20132413, 21868451, 32830857, 34215221, 35132081
Breast Neoplasms Stimulate 35225467
Carcinogenesis Associate 18186570
Carcinoma Adenoid Cystic Associate 21692051
Carcinoma Endometrioid Associate 29060924