Gene Gene information from NCBI Gene database.
Entrez ID 5307
Gene name Paired like homeodomain 1
Gene symbol PITX1
Synonyms (NCBI Gene)
BFTCCFLBNBGPOTXPTX1
Chromosome 5
Chromosome location 5q31.1
Summary This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs370433085 G>A,C Likely-pathogenic Coding sequence variant, synonymous variant, stop gained
rs730882191 GCCGTACGGGCAAGCGCCCGGCGACATGGCCGAGT>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
181
miRTarBase ID miRNA Experiments Reference
MIRT049789 hsa-miR-92a-3p CLASH 23622248
MIRT045636 hsa-miR-149-5p CLASH 23622248
MIRT044749 hsa-miR-320a CLASH 23622248
MIRT043542 hsa-miR-331-3p CLASH 23622248
MIRT614517 hsa-miR-431-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602149 9004 ENSG00000069011
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78337
Protein name Pituitary homeobox 1 (Hindlimb-expressed homeobox protein backfoot) (Homeobox protein PITX1) (Paired-like homeodomain transcription factor 1)
Protein function Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 90 146 Homeodomain Domain
PF03826 OAR 276 293 OAR motif Motif
Sequence
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKER
GGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE
EIAVWTNLTEPRVRVWFKNRRAKWRK
RERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYS
YNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS
GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL
QGPASGLNACQYNS
Sequence length 314
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
22
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clubfoot Likely pathogenic; Pathogenic rs1752408604, rs2149562896, rs121909109, rs2479672475, rs730882191 RCV001335965
RCV001785380
RCV000007934
RCV003223529
RCV000030814
Hurler syndrome Likely pathogenic rs1752408637 RCV001201163
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Brachydactyly-elbow wrist dysplasia syndrome Benign; Uncertain significance rs141612135, rs2479667020, rs479632 RCV001716244
RCV002470409
RCV001788189
Micrognathia Conflicting classifications of pathogenicity rs141612135 RCV001199403
PITX1-related disorder Likely benign; Uncertain significance rs371250970, rs1240871076, rs200888898, rs752690307 RCV003978605
RCV003418574
RCV003947910
RCV003418804
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Absence of Tibia Associate 18950742, 22258522
Adamantinoma Associate 22258522
Adenocarcinoma of Lung Associate 32294625, 33530195
Adenoma Associate 18079591
Autistic Disorder Associate 18053270
Breast Neoplasms Associate 20132413, 21868451, 32830857, 34215221, 35132081
Breast Neoplasms Stimulate 35225467
Carcinogenesis Associate 18186570
Carcinoma Adenoid Cystic Associate 21692051
Carcinoma Endometrioid Associate 29060924