PIP (prolactin induced protein)

Gene

• Entrez ID: 5304
• Gene name: Prolactin induced protein
• Gene symbol: PIP
• Synonyms (NCBI Gene): BRST-2, GCDFP-15, GCDFP15, GPIP4
• Chromosome: 7
• Chromosome location: 7q34

Transcription factors

Transcription factor	Regulation	Reference
AR	Unknown	21809344
RUNX2	Unknown	21809344

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	NAS	2013294
GO:0004190	Function	Aspartic-type endopeptidase activity	IBA
GO:0004190	Function	Aspartic-type endopeptidase activity	IMP	10713110
GO:0005515	Function	Protein binding	IPI	18930737, 22720776, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10713110, 14638438, 18930737, 24248522
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	22720776
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IMP	10713110
GO:0010628	Process	Positive regulation of gene expression	IDA	10072505
GO:0019864	Function	IgG binding	IDA	14638438
GO:0042802	Function	Identical protein binding	IPI	10713110
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070233	Process	Negative regulation of T cell apoptotic process	IMP	10072505

Other IDs

• MIM: 176720
• HGNC: 8993
• e!Ensembl: ENSG00000159763

Protein

• UniProt ID: P12273
• Protein name: Prolactin-inducible protein (Gross cystic disease fluid protein 15) (GCDFP-15) (Prolactin-induced protein) (Secretory actin-binding protein) (SABP) (gp17)
• PDB: 3ES6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05326	SVA	3 → 126	Seminal vesicle autoantigen (SVA)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
• Sequence:

  MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQT
  ELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIREL
  GICPDDAAVIPIKNNRFYTIEILKVE

• Sequence length: 146

Pathways

Reactome:

Miscellaneous transport and binding events