Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5300
Gene name Gene Name - the full gene name approved by the HGNC.	Peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIN1
Synonyms (NCBI Gene) Gene synonyms aliases	DOD, UBL5
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-ph

Show/Hide all(193)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043127	hsa-miR-324-5p	CLASH	23622248
MIRT042314	hsa-miR-484	CLASH	23622248
MIRT437915	hsa-miR-200c-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24786790
MIRT437915	hsa-miR-200c-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24786790
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451213	hsa-miR-6870-3p	PAR-CLIP	23592263
MIRT451212	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT451211	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT451210	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451209	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451208	hsa-miR-4320	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451207	hsa-miR-3125	PAR-CLIP	23592263
MIRT451206	hsa-miR-3916	PAR-CLIP	23592263
MIRT451205	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451204	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT451203	hsa-miR-2392	PAR-CLIP	23592263
MIRT451202	hsa-miR-4733-5p	PAR-CLIP	23592263
MIRT451201	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT451200	hsa-miR-4302	PAR-CLIP	23592263
MIRT451199	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT451198	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451194	hsa-miR-1255a	PAR-CLIP	23592263
MIRT451193	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT451192	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451191	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT451190	hsa-miR-8085	PAR-CLIP	23592263
MIRT451189	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451186	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451185	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451184	hsa-miR-5698	PAR-CLIP	23592263
MIRT451183	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451182	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451181	hsa-miR-4525	PAR-CLIP	23592263
MIRT451180	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451179	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT451178	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT451177	hsa-miR-4447	PAR-CLIP	23592263
MIRT451176	hsa-miR-4472	PAR-CLIP	23592263
MIRT451175	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT451174	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT451173	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT451172	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT451171	hsa-miR-1275	PAR-CLIP	23592263
MIRT451170	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT451169	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT451168	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	28383568
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	28383568
MIRT438126	hsa-miR-296-5p	ELISA	32584920
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451213	hsa-miR-6870-3p	PAR-CLIP	23592263
MIRT451212	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT451211	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT451210	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451209	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451208	hsa-miR-4320	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451207	hsa-miR-3125	PAR-CLIP	23592263
MIRT451206	hsa-miR-3916	PAR-CLIP	23592263
MIRT451205	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451204	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT451203	hsa-miR-2392	PAR-CLIP	23592263
MIRT451202	hsa-miR-4733-5p	PAR-CLIP	23592263
MIRT451201	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT451200	hsa-miR-4302	PAR-CLIP	23592263
MIRT451199	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT451198	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451194	hsa-miR-1255a	PAR-CLIP	23592263
MIRT451193	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT451192	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451191	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT451190	hsa-miR-8085	PAR-CLIP	23592263
MIRT451189	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451186	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451185	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451184	hsa-miR-5698	PAR-CLIP	23592263
MIRT451183	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451182	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451181	hsa-miR-4525	PAR-CLIP	23592263
MIRT451180	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451179	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT451178	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT451177	hsa-miR-4447	PAR-CLIP	23592263
MIRT451176	hsa-miR-4472	PAR-CLIP	23592263
MIRT451175	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT451174	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT451173	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT451172	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT451171	hsa-miR-1275	PAR-CLIP	23592263
MIRT451170	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT451169	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT451168	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT1235325	hsa-miR-1204	CLIP-seq
MIRT1235326	hsa-miR-1224-3p	CLIP-seq
MIRT1235327	hsa-miR-1245b-5p	CLIP-seq
MIRT1235328	hsa-miR-1260	CLIP-seq
MIRT1235329	hsa-miR-1260b	CLIP-seq
MIRT1235330	hsa-miR-1280	CLIP-seq
MIRT1235331	hsa-miR-3126-3p	CLIP-seq
MIRT1235332	hsa-miR-3142	CLIP-seq
MIRT1235333	hsa-miR-3180	CLIP-seq
MIRT1235334	hsa-miR-3180-3p	CLIP-seq
MIRT1235335	hsa-miR-3194-3p	CLIP-seq
MIRT1235336	hsa-miR-3196	CLIP-seq
MIRT1235337	hsa-miR-4462	CLIP-seq
MIRT1235338	hsa-miR-4475	CLIP-seq
MIRT1235339	hsa-miR-4650-5p	CLIP-seq
MIRT1235340	hsa-miR-4665-3p	CLIP-seq
MIRT1235341	hsa-miR-4753-3p	CLIP-seq
MIRT1235342	hsa-miR-532-3p	CLIP-seq
MIRT1235343	hsa-miR-602	CLIP-seq
MIRT1235344	hsa-miR-628-5p	CLIP-seq
MIRT1235345	hsa-miR-637	CLIP-seq
MIRT1235346	hsa-miR-760	CLIP-seq
MIRT1235347	hsa-miR-9	CLIP-seq
MIRT1235348	hsa-miR-942	CLIP-seq
MIRT1556804	hsa-miR-3121-5p	CLIP-seq
MIRT1556805	hsa-miR-450a	CLIP-seq
MIRT1556806	hsa-miR-4724-5p	CLIP-seq
MIRT1235326	hsa-miR-1224-3p	CLIP-seq
MIRT1235328	hsa-miR-1260	CLIP-seq
MIRT1235329	hsa-miR-1260b	CLIP-seq
MIRT1235330	hsa-miR-1280	CLIP-seq
MIRT2069276	hsa-miR-1915	CLIP-seq
MIRT1235331	hsa-miR-3126-3p	CLIP-seq
MIRT2069277	hsa-miR-3144-5p	CLIP-seq
MIRT2069278	hsa-miR-3191	CLIP-seq
MIRT2069279	hsa-miR-3918	CLIP-seq
MIRT2069280	hsa-miR-4300	CLIP-seq
MIRT1235338	hsa-miR-4475	CLIP-seq
MIRT2069281	hsa-miR-4652-5p	CLIP-seq
MIRT2069282	hsa-miR-4685-5p	CLIP-seq
MIRT1235342	hsa-miR-532-3p	CLIP-seq
MIRT2069283	hsa-miR-920	CLIP-seq
MIRT2296338	hsa-miR-1178	CLIP-seq
MIRT2296339	hsa-miR-4257	CLIP-seq
MIRT2296340	hsa-miR-4641	CLIP-seq
MIRT2392545	hsa-miR-3652	CLIP-seq
MIRT2392546	hsa-miR-3659	CLIP-seq
MIRT2392547	hsa-miR-4255	CLIP-seq
MIRT2392548	hsa-miR-4430	CLIP-seq
MIRT2392549	hsa-miR-4505	CLIP-seq
MIRT2392550	hsa-miR-4658	CLIP-seq
MIRT2392551	hsa-miR-574-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
E2F1	Unknown	20376080

Show/Hide all(71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000413	Process	Protein peptidyl-prolyl isomerization	IDA	29686383
GO:0001666	Process	Response to hypoxia	IDA	25576397
GO:0001934	Process	Positive regulation of protein phosphorylation	IGI	19638580
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	EXP	20956805
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IDA	19122240, 26942675, 29686383
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	NAS	16697218
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	TAS	11533658, 24964035
GO:0003774	Function	Cytoskeletal motor activity	ISS
GO:0005515	Function	Protein binding	IPI	11470801, 16189514, 16476580, 16554819, 17906639, 18628984, 19122240, 19131971, 19151708, 19439498, 20179103, 20179161, 20622153, 21516116, 21741598, 21743479, 21847096, 21900206, 21988832, 22158035, 23911326, 24113655, 24265246, 24267382, 25416956, 26655473, 26942675, 28514442, 296
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16697218, 20179103, 25576397
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8606777, 16697218
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16697218, 25576397
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006626	Process	Protein targeting to mitochondrion	IMP	26942675
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	10391244
GO:0007266	Process	Rho protein signal transduction	IMP	20179103
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	11533658
GO:0008013	Function	Beta-catenin binding	ISS
GO:0010468	Process	Regulation of gene expression	IDA	24964035
GO:0016607	Component	Nuclear speck	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0016859	Function	Cis-trans isomerase activity	IMP	25576397
GO:0030182	Process	Neuron differentiation	ISS
GO:0030496	Component	Midbody	IDA	19638580
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	19122240
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IPI	20179103
GO:0031647	Process	Regulation of protein stability	IMP	25576397
GO:0032465	Process	Regulation of cytokinesis	IEA
GO:0032465	Process	Regulation of cytokinesis	IGI	19638580
GO:0032465	Process	Regulation of cytokinesis	IMP	19638580
GO:0032794	Function	GTPase activating protein binding	IPI	20179103
GO:0036064	Component	Ciliary basal body	IDA	29257953
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	11533658
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11533658
GO:0046785	Process	Microtubule polymerization	IDA	26996940
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050808	Process	Synapse organization	ISS
GO:0050815	Function	Phosphoserine residue binding	IDA	10037602, 11533658
GO:0050816	Function	Phosphothreonine residue binding	IDA	10037602
GO:0050816	Function	Phosphothreonine residue binding	IPI	10037602
GO:0050821	Process	Protein stabilization	IDA	11533658
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051219	Function	Phosphoprotein binding	ISS	23362255
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	19122240, 24964035
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	20179103
GO:0071456	Process	Cellular response to hypoxia	IMP	26942675
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	11533658
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	28458925
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099524	Component	Postsynaptic cytosol	IDA	28458925
GO:1900180	Process	Regulation of protein localization to nucleus	IDA	11533658
GO:1902430	Process	Negative regulation of amyloid-beta formation	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	25576397
GO:1902430	Process	Negative regulation of amyloid-beta formation	ISS
GO:1990757	Function	Ubiquitin ligase activator activity	IDA	19122240
GO:2000146	Process	Negative regulation of cell motility	IDA	20179103

MIM	HGNC	e!Ensembl
601052	8988	ENSG00000127445

Protein

UniProt ID

Q13526

Protein name

Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase Pin1) (PPIase Pin1) (Rotamase Pin1)

Protein function

Peptidyl-prolyl cis/trans isomerase (PPIase) that binds to and isomerizes specific phosphorylated Ser/Thr-Pro (pSer/Thr-Pro) motifs (PubMed:21497122, PubMed:23623683, PubMed:29686383). By inducing conformational changes in a subset of phosphoryl

PDB

1F8A , 1I6C , 1I8G , 1I8H , 1NMV , 1NMW , 1PIN , 1ZCN , 2F21 , 2ITK , 2KBU , 2KCF , 2LB3 , 2M8I , 2M8J , 2M9E , 2M9F , 2M9I , 2M9J , 2N1O , 2Q5A , 2RUC , 2RUD , 2RUQ , 2RUR , 2XP3 , 2XP4 , 2XP5 , 2XP6 , 2XP7 , 2XP8 , 2XP9 , 2XPA , 2XPB , 2ZQS , 2ZQT , 2ZQU , 2ZQV , 2ZR4 , 2ZR5 , 2ZR6 , 3I6C , 3IK8 , 3IKD , 3IKG , 3JYJ , 3KAB , 3KAC , 3KAD , 3KAF , 3KAG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00397	WW	7 → 37	WW domain	Domain
PF00639	Rotamase	59 → 163	PPIC-type PPIASE domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in immune cells in the lung (at protein level) (PubMed:29686383). The phosphorylated form at Ser-71 is expressed in normal breast tissue cells but not in breast cancer cells. {ECO:0000269|PubMed:17828269, ECO:0000269|PubMed:2

Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Sequence length

163

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 RIG-I-like receptor signaling pathway		ISG15 antiviral mechanism RHO GTPases Activate NADPH Oxidases Regulation of TP53 Activity through Phosphorylation PI5P Regulates TP53 Acetylation Negative regulators of DDX58/IFIH1 signaling

PIN1 (peptidylprolyl cis/trans isomerase, NIMA-interacting 1)