PIN1 (peptidylprolyl cis/trans isomerase, NIMA-interacting 1)

Gene

• Entrez ID: 5300
• Gene name: Peptidylprolyl cis/trans isomerase, NIMA-interacting 1
• Gene symbol: PIN1
• Synonyms (NCBI Gene): DOD, UBL5
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-ph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043127	hsa-miR-324-5p	CLASH	23622248
MIRT042314	hsa-miR-484	CLASH	23622248
MIRT437915	hsa-miR-200c-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24786790
MIRT437915	hsa-miR-200c-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24786790
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438291	hsa-miR-200b-3p	Luciferase reporter assay	24072701
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438128	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438127	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT438126	hsa-miR-296-5p	Luciferase reporter assay	24915000
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451213	hsa-miR-6870-3p	PAR-CLIP	23592263
MIRT451212	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT451211	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT451210	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451209	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451208	hsa-miR-4320	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451207	hsa-miR-3125	PAR-CLIP	23592263
MIRT451206	hsa-miR-3916	PAR-CLIP	23592263
MIRT451205	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451204	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT451203	hsa-miR-2392	PAR-CLIP	23592263
MIRT451202	hsa-miR-4733-5p	PAR-CLIP	23592263
MIRT451201	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT451200	hsa-miR-4302	PAR-CLIP	23592263
MIRT451199	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT451198	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451194	hsa-miR-1255a	PAR-CLIP	23592263
MIRT451193	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT451192	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451191	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT451190	hsa-miR-8085	PAR-CLIP	23592263
MIRT451189	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451186	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451185	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451184	hsa-miR-5698	PAR-CLIP	23592263
MIRT451183	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451182	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451181	hsa-miR-4525	PAR-CLIP	23592263
MIRT451180	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451179	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT451178	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT451177	hsa-miR-4447	PAR-CLIP	23592263
MIRT451176	hsa-miR-4472	PAR-CLIP	23592263
MIRT451175	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT451174	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT451173	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT451172	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT451171	hsa-miR-1275	PAR-CLIP	23592263
MIRT451170	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT451169	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT451168	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26150353
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	28383568
MIRT731483	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	28383568
MIRT438126	hsa-miR-296-5p	ELISA	32584920
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451213	hsa-miR-6870-3p	PAR-CLIP	23592263
MIRT451212	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT451211	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT451210	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451209	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451208	hsa-miR-4320	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451207	hsa-miR-3125	PAR-CLIP	23592263
MIRT451206	hsa-miR-3916	PAR-CLIP	23592263
MIRT451205	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451204	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT451203	hsa-miR-2392	PAR-CLIP	23592263
MIRT451202	hsa-miR-4733-5p	PAR-CLIP	23592263
MIRT451201	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT451200	hsa-miR-4302	PAR-CLIP	23592263
MIRT451199	hsa-miR-199a-5p	PAR-CLIP	23592263
MIRT451198	hsa-miR-199b-5p	PAR-CLIP	23592263
MIRT451197	hsa-miR-5090	PAR-CLIP	23592263
MIRT451196	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT451195	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT451194	hsa-miR-1255a	PAR-CLIP	23592263
MIRT451193	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT451192	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT451191	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT451190	hsa-miR-8085	PAR-CLIP	23592263
MIRT451189	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT451188	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT451187	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT451186	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451185	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451184	hsa-miR-5698	PAR-CLIP	23592263
MIRT451183	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451182	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451181	hsa-miR-4525	PAR-CLIP	23592263
MIRT451180	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451179	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT451178	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT451177	hsa-miR-4447	PAR-CLIP	23592263
MIRT451176	hsa-miR-4472	PAR-CLIP	23592263
MIRT451175	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT451174	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT451173	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT451172	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT451171	hsa-miR-1275	PAR-CLIP	23592263
MIRT451170	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT451169	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT451168	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT1235325	hsa-miR-1204	CLIP-seq
MIRT1235326	hsa-miR-1224-3p	CLIP-seq
MIRT1235327	hsa-miR-1245b-5p	CLIP-seq
MIRT1235328	hsa-miR-1260	CLIP-seq
MIRT1235329	hsa-miR-1260b	CLIP-seq
MIRT1235330	hsa-miR-1280	CLIP-seq
MIRT1235331	hsa-miR-3126-3p	CLIP-seq
MIRT1235332	hsa-miR-3142	CLIP-seq
MIRT1235333	hsa-miR-3180	CLIP-seq
MIRT1235334	hsa-miR-3180-3p	CLIP-seq
MIRT1235335	hsa-miR-3194-3p	CLIP-seq
MIRT1235336	hsa-miR-3196	CLIP-seq
MIRT1235337	hsa-miR-4462	CLIP-seq
MIRT1235338	hsa-miR-4475	CLIP-seq
MIRT1235339	hsa-miR-4650-5p	CLIP-seq
MIRT1235340	hsa-miR-4665-3p	CLIP-seq
MIRT1235341	hsa-miR-4753-3p	CLIP-seq
MIRT1235342	hsa-miR-532-3p	CLIP-seq
MIRT1235343	hsa-miR-602	CLIP-seq
MIRT1235344	hsa-miR-628-5p	CLIP-seq
MIRT1235345	hsa-miR-637	CLIP-seq
MIRT1235346	hsa-miR-760	CLIP-seq
MIRT1235347	hsa-miR-9	CLIP-seq
MIRT1235348	hsa-miR-942	CLIP-seq
MIRT1556804	hsa-miR-3121-5p	CLIP-seq
MIRT1556805	hsa-miR-450a	CLIP-seq
MIRT1556806	hsa-miR-4724-5p	CLIP-seq
MIRT1235326	hsa-miR-1224-3p	CLIP-seq
MIRT1235328	hsa-miR-1260	CLIP-seq
MIRT1235329	hsa-miR-1260b	CLIP-seq
MIRT1235330	hsa-miR-1280	CLIP-seq
MIRT2069276	hsa-miR-1915	CLIP-seq
MIRT1235331	hsa-miR-3126-3p	CLIP-seq
MIRT2069277	hsa-miR-3144-5p	CLIP-seq
MIRT2069278	hsa-miR-3191	CLIP-seq
MIRT2069279	hsa-miR-3918	CLIP-seq
MIRT2069280	hsa-miR-4300	CLIP-seq
MIRT1235338	hsa-miR-4475	CLIP-seq
MIRT2069281	hsa-miR-4652-5p	CLIP-seq
MIRT2069282	hsa-miR-4685-5p	CLIP-seq
MIRT1235342	hsa-miR-532-3p	CLIP-seq
MIRT2069283	hsa-miR-920	CLIP-seq
MIRT2296338	hsa-miR-1178	CLIP-seq
MIRT2296339	hsa-miR-4257	CLIP-seq
MIRT2296340	hsa-miR-4641	CLIP-seq
MIRT2392545	hsa-miR-3652	CLIP-seq
MIRT2392546	hsa-miR-3659	CLIP-seq
MIRT2392547	hsa-miR-4255	CLIP-seq
MIRT2392548	hsa-miR-4430	CLIP-seq
MIRT2392549	hsa-miR-4505	CLIP-seq
MIRT2392550	hsa-miR-4658	CLIP-seq
MIRT2392551	hsa-miR-574-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	20376080

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000413	Process	Protein peptidyl-prolyl isomerization	TAS	11533658
GO:0001666	Process	Response to hypoxia	IDA	25576397
GO:0001932	Process	Regulation of protein phosphorylation	IDA	24964035
GO:0001934	Process	Positive regulation of protein phosphorylation	IGI	19638580
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	EXP	20956805
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA	21873635
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IDA	19122240
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	NAS	16697218
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	TAS	11533658, 24964035
GO:0003774	Function	Motor activity	ISS
GO:0005515	Function	Protein binding	IPI	11470801, 16189514, 16476580, 16554819, 17906639, 18628984, 19122240, 19131971, 19151708, 19439498, 20179103, 20179161, 20622153, 21516116, 21741598, 21743479, 21847096, 21900206, 21988832, 22158035, 23911326, 24113655, 24265246, 24267382, 25416956, 26655473, 29892012, 31270457, 315
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	16697218, 20179103, 25576397
GO:0005634	Component	Nucleus	TAS	16697218
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16697218, 25576397
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0007049	Process	Cell cycle	IEA
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	10391244
GO:0008013	Function	Beta-catenin binding	IPI	11533658
GO:0008013	Function	Beta-catenin binding	ISS
GO:0010468	Process	Regulation of gene expression	IDA	24964035
GO:0016607	Component	Nuclear speck	IEA
GO:0016859	Function	Cis-trans isomerase activity	IMP	25576397
GO:0030182	Process	Neuron differentiation	ISS
GO:0030496	Component	Midbody	IDA	19638580
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	19122240
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IPI	20179103
GO:0031647	Process	Regulation of protein stability	IMP	25576397
GO:0032091	Process	Negative regulation of protein binding	IDA	11533658
GO:0032092	Process	Positive regulation of protein binding	IDA	24964035
GO:0032465	Process	Regulation of cytokinesis	IGI	19638580
GO:0032465	Process	Regulation of cytokinesis	IMP	19638580
GO:0032480	Process	Negative regulation of type I interferon production	TAS
GO:0032794	Function	GTPase activating protein binding	IPI	20179103
GO:0035307	Process	Positive regulation of protein dephosphorylation	TAS	23362255
GO:0036064	Component	Ciliary basal body	IDA	29257953
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	11533658
GO:0043005	Component	Neuron projection	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IMP	20179103
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11533658
GO:0046785	Process	Microtubule polymerization	IDA	26996940
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050808	Process	Synapse organization	ISS
GO:0050815	Function	Phosphoserine residue binding	IDA	10037602, 11533658
GO:0050816	Function	Phosphothreonine residue binding	IDA	10037602
GO:0050816	Function	Phosphothreonine residue binding	IPI	10037602
GO:0050821	Process	Protein stabilization	IDA	11533658
GO:0050821	Process	Protein stabilization	ISS
GO:0051219	Function	Phosphoprotein binding	ISS	23362255
GO:0051443	Process	Positive regulation of ubiquitin-protein transferase activity	IDA	19122240
GO:0060393	Process	Regulation of pathway-restricted SMAD protein phosphorylation	IDA	19122240
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	20179103
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	11533658
GO:0098978	Component	Glutamatergic synapse	IDA	28458925
GO:0099524	Component	Postsynaptic cytosol	IDA	28458925
GO:1900180	Process	Regulation of protein localization to nucleus	IDA	11533658
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	25576397
GO:1902430	Process	Negative regulation of amyloid-beta formation	ISS
GO:2000146	Process	Negative regulation of cell motility	IDA	20179103

Other IDs

• MIM: 601052
• HGNC: 8988
• e!Ensembl: ENSG00000127445

Protein

• UniProt ID: Q13526
• Protein name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase Pin1) (PPIase Pin1) (Rotamase Pin1)
• Protein function: Peptidyl-prolyl cis/trans isomerase (PPIase) that binds to and isomerizes specific phosphorylated Ser/Thr-Pro (pSer/Thr-Pro) motifs (PubMed:21497122, PubMed:23623683, PubMed:29686383). By inducing conformational changes in a subset of phosphoryl
• PDB: 1F8A, 1I6C, 1I8G, 1I8H, 1NMV, 1NMW, 1PIN, 1ZCN, 2F21, 2ITK, 2KBU, 2KCF, 2LB3, 2M8I, 2M8J, 2M9E, 2M9F, 2M9I, 2M9J, 2N1O, 2Q5A, 2RUC, 2RUD, 2RUQ, 2RUR, 2XP3, 2XP4, 2XP5, 2XP6, 2XP7, 2XP8, 2XP9, 2XPA, 2XPB, 2ZQS, 2ZQT, 2ZQU, 2ZQV, 2ZR4, 2ZR5, 2ZR6, 3I6C, 3IK8, 3IKD, 3IKG, 3JYJ, 3KAB, 3KAC, 3KAD, 3KAF, 3KAG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00397	WW	7 → 37	WW domain	Domain
  PF00639	Rotamase	59 → 163	PPIC-type PPIASE domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in immune cells in the lung (at protein level) (PubMed:29686383). The phosphorylated form at Ser-71 is expressed in normal breast tissue cells but not in breast cancer cells. {ECO:0000269|PubMed:17828269, ECO:0000269|PubMed:2
• Sequence:

  MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
  LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
  DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

• Sequence length: 163

Pathways

KEGG:

Viral life cycle - HIV-1
RIG-I-like receptor signaling pathway

Reactome:

ISG15 antiviral mechanism
RHO GTPases Activate NADPH Oxidases
Regulation of TP53 Activity through Phosphorylation
PI5P Regulates TP53 Acetylation
Negative regulators of DDX58/IFIH1 signaling

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	19671742, 19681904
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	19671742, 19681904
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	19681904, 19671742

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	26752745
Adrenal Insufficiency	Associate	23096908
Aging Premature	Associate	20580132
Alzheimer Disease	Associate	11432833, 16384626, 17482359, 19909517, 20580132, 22184106, 23697802, 29775635, 38554950
Alzheimer Disease	Stimulate	21243369
Anophthalmia with pulmonary hypoplasia	Stimulate	32347623
Asthma	Associate	28125291
Atherosclerosis	Associate	29545340
Blood Coagulation Disorders	Associate	29545340
Breast Neoplasms	Stimulate	11432833, 12101225, 15111319
Breast Neoplasms	Associate	18039859, 18676833, 19077306, 19681904, 20033770, 20180533, 21573702, 22580604, 23390529, 23542176, 24072701, 25675300, 25818297, 28678584, 31015482, 32193285, 32961044
Brenner Tumor	Stimulate	15111319
Calcinosis Cutis	Associate	31324164
Carcinogenesis	Associate	19619441, 22608923, 23708493, 25160749, 25818297, 30442923, 31015482, 32127141
Carcinoma Ductal	Stimulate	37833434
Carcinoma Ductal Breast	Associate	37833434
Carcinoma Hepatocellular	Associate	26461058, 26643892, 29118189, 30170446, 31324164
Carcinoma Intraductal Noninfiltrating	Stimulate	37833434
Carcinoma Non Small Cell Lung	Stimulate	19619441
Carcinoma Pancreatic Ductal	Associate	36834887
Carcinoma Squamous Cell	Associate	24715170
Cardiovascular Diseases	Associate	36012132
Cell Transformation Neoplastic	Associate	25818297
Cerebral Infarction	Associate	40442227
Colorectal Neoplasms	Associate	16124054, 25982393, 27008710, 29925895
Corneal Endothelial Cell Loss	Associate	33148187
Coronary Disease	Associate	33358249
Dementia	Associate	33300824
Diabetes Mellitus	Associate	33148187
Drug Related Side Effects and Adverse Reactions	Associate	22944098
Esophageal Squamous Cell Carcinoma	Associate	25160749
Fanconi Anemia	Associate	30789902
Fatty Liver Alcoholic	Stimulate	37240193
Focal Nodular Hyperplasia	Associate	27600827
Glioblastoma	Associate	17938171, 32592588
Glioma	Associate	17938171, 23708493, 32592588, 38167292
Glucose Metabolism Disorders	Associate	31614723
Hematologic Neoplasms	Associate	19131583
Hepatitis B	Associate	26643892
Hepatitis B Chronic	Associate	30170446
HTLV I Infections	Associate	20529865
Hyperparathyroidism Secondary	Associate	27600827, 27876426
Hypertension	Associate	33148187
Idiopathic Hypogonadotropic Hypogonadism	Associate	23096908
Inflammation	Associate	30170446, 32127141, 32347623, 33148187, 36012132, 36707636
Leukemia	Associate	20376080
Leukemia Myeloid Acute	Associate	20376080, 34047175
Leukemia Promyelocytic Acute	Associate	36813923
Liver Cirrhosis	Associate	30170446
Lung Neoplasms	Associate	26752745, 28592245, 33162791
Lymphatic Metastasis	Associate	19619441, 24072701
Mammary Neoplasms Animal	Associate	12101225
Melanoma	Stimulate	15111319
Melanoma	Associate	26279295, 30442923
Melanoma Cutaneous Malignant	Stimulate	30442923
Metabolic Diseases	Associate	31614723
Mitochondrial Diseases	Associate	15788397
Nasopharyngeal Carcinoma	Associate	28676695
Neoplasm Metastasis	Associate	32347623, 36813923
Neoplasm Metastasis	Stimulate	32703934
Neoplasms	Associate	11432833, 12101225, 15111319, 17938171, 18039859, 19077306, 19151708, 19625347, 20033770, 20180533, 22322860, 22580604, 22608923, 22894932, 23697802, 23708493, 24715170, 25335736, 25675300, 25818297, 26461058, 26643892, 29523761, 29775635, 29925895, 30442923, 31083670, 32127141, 32347623, 32592588, 32669350, 32703934, 36813923, 37105032, 37833434, 38167292
Neoplasms	Stimulate	25160749
Nerve Degeneration	Associate	11432833
Neurodegenerative Diseases	Associate	19909517, 31614723
Neurotoxicity Syndromes	Associate	31614723
Pancreatic Neoplasms	Associate	32347623
Pancreatic Neoplasms	Stimulate	36834887
Precancerous Conditions	Associate	32127141
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	29665256
Pressure Ulcer	Associate	33148187
Prostate cancer familial	Associate	32193285
Prostatic Neoplasms	Associate	15111319, 22894932, 24915000, 30595538
Renal Insufficiency Chronic	Associate	27876426
Squamous Cell Carcinoma of Head and Neck	Associate	19625347, 20033770, 25335736
Stomach Neoplasms	Associate	28481868, 32703934, 37929660
Thrombosis	Associate	29545340
Thyroid Cancer Papillary	Associate	27029791
Triple Negative Breast Neoplasms	Associate	28678584, 36813923
Uterine Cervical Neoplasms	Associate	30606896, 32127141