Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5268
Gene name Gene Name - the full gene name approved by the HGNC.	Serpin family B member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SERPINB5
Synonyms (NCBI Gene) Gene synonyms aliases	PI5, maspin
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q21.33

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003567	hsa-miR-21-5p	Luciferase reporter assay, Western blot	18270520
MIRT003567	hsa-miR-21-5p	Review	19935707
MIRT003567	hsa-miR-21-5p	Luciferase reporter assay	18270520
MIRT003567	hsa-miR-21-5p	Review	19815577
MIRT003567	hsa-miR-21-5p	Luciferase reporter assay	19253296
MIRT002776	hsa-miR-1-3p	Microarray	15685193
MIRT017272	hsa-miR-335-5p	Microarray	18185580
MIRT002776	hsa-miR-1-3p	Proteomics	18668040
MIRT002776	hsa-miR-1-3p	Microarray;Other	15685193
MIRT028408	hsa-miR-30a-5p	Proteomics	18668040
MIRT029183	hsa-miR-26b-5p	Microarray	19088304
MIRT003567	hsa-miR-21-5p	Reporter assay;Western blot;qRT-PCR	21636785
MIRT003567	hsa-miR-21-5p	Reporter assay	20693317
MIRT031536	hsa-miR-16-5p	Proteomics	18668040
MIRT662448	hsa-miR-5197-3p	HITS-CLIP	23824327
MIRT662447	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT662446	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT662445	hsa-miR-3185	HITS-CLIP	23824327
MIRT662444	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT731526	hsa-miR-7-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731526	hsa-miR-7-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT003567	hsa-miR-21-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT003567	hsa-miR-21-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731528	hsa-miR-103a-3p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731528	hsa-miR-103a-3p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731529	hsa-miR-107	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731529	hsa-miR-107	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26296971
MIRT731526	hsa-miR-7-5p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27409165
MIRT731528	hsa-miR-103a-3p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27409165
MIRT731529	hsa-miR-107	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27409165
MIRT003567	hsa-miR-21-5p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27409165
MIRT662448	hsa-miR-5197-3p	HITS-CLIP	23824327
MIRT662447	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT662446	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT662445	hsa-miR-3185	HITS-CLIP	23824327
MIRT662444	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT1338692	hsa-miR-1302	CLIP-seq
MIRT1338693	hsa-miR-34b	CLIP-seq
MIRT1338694	hsa-miR-3613-3p	CLIP-seq
MIRT1338695	hsa-miR-3646	CLIP-seq
MIRT1338696	hsa-miR-3662	CLIP-seq
MIRT1338697	hsa-miR-3663-3p	CLIP-seq
MIRT1338698	hsa-miR-4298	CLIP-seq
MIRT1338693	hsa-miR-34b	CLIP-seq
MIRT2100131	hsa-miR-4263	CLIP-seq
MIRT2100132	hsa-miR-4420	CLIP-seq
MIRT2100133	hsa-miR-4436b-3p	CLIP-seq
MIRT2100134	hsa-miR-4509	CLIP-seq
MIRT2100135	hsa-miR-4685-5p	CLIP-seq
MIRT2100136	hsa-miR-4744	CLIP-seq
MIRT2100137	hsa-miR-4799-5p	CLIP-seq
MIRT2100138	hsa-miR-576-5p	CLIP-seq
MIRT2325021	hsa-miR-1299	CLIP-seq
MIRT2325022	hsa-miR-3677-3p	CLIP-seq
MIRT2325023	hsa-miR-4535	CLIP-seq
MIRT2325024	hsa-miR-492	CLIP-seq
MIRT2394232	hsa-miR-1273f	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
AR	Repression	16304843
E2F1	Activation	20197383
HDAC1	Unknown	10709100
SP1	Activation	17376297
SPDEF	Activation	12907642

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	16049006, 20211623
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	16049006
GO:0005737	Component	Cytoplasm	IEA
GO:0016528	Component	Sarcoplasm	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0060512	Process	Prostate gland morphogenesis	IEA

MIM	HGNC	e!Ensembl
154790	8949	ENSG00000206075

Protein

UniProt ID

P36952

Protein name

Serpin B5 (Maspin) (Peptidase inhibitor 5) (PI-5)

Protein function

Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhi

PDB

1WZ9 , 1XQG , 1XQJ , 1XU8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 375	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Normal mammary epithelial cells.

Sequence

MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD
FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESET
KECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES
TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED
TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH
NKTRNIIFFGKFCSP

Sequence length

375

Interactions

View interactions

	KEGG
	p53 signaling pathway MicroRNAs in cancer

SERPINB5 (serpin family B member 5)