Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
525
Gene name Gene Name - the full gene name approved by the HGNC.
ATPase H+ transporting V1 subunit B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATP6V1B1
Synonyms (NCBI Gene) Gene synonyms aliases
ATP6B1, DRTA2, RTA1B, VATB, VMA2, VPP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121964879 C>T Pathogenic Genic upstream transcript variant, stop gained, coding sequence variant
rs121964880 T>C Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs121964881 G>A Pathogenic Coding sequence variant, missense variant
rs145536062 C>T Pathogenic-likely-pathogenic, likely-pathogenic Coding sequence variant, stop gained
rs145735762 C>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT568914 hsa-miR-1321 PAR-CLIP 20371350
MIRT568912 hsa-miR-4739 PAR-CLIP 20371350
MIRT568913 hsa-miR-4756-5p PAR-CLIP 20371350
MIRT568911 hsa-miR-1247-3p PAR-CLIP 20371350
MIRT568910 hsa-miR-4537 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000221 Component Vacuolar proton-transporting V-type ATPase, V1 domain IDA 33065002
GO:0000221 Component Vacuolar proton-transporting V-type ATPase, V1 domain IEA
GO:0001503 Process Ossification IMP 16433694
GO:0003091 Process Renal water homeostasis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
192132 853 ENSG00000116039
Protein
UniProt ID P15313
Protein name V-type proton ATPase subunit B, kidney isoform (V-ATPase subunit B 1) (Endomembrane proton pump 58 kDa subunit) (Vacuolar proton pump subunit B 1)
Protein function Non-catalytic subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:16769747). V-ATPase
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02874 ATP-synt_ab_N 44 110 ATP synthase alpha/beta family, beta-barrel domain Domain
PF00006 ATP-synt_ab 167 393 ATP synthase alpha/beta family, nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Kidney; localizes to early distal nephron, encompassing thick ascending limbs and distal convoluted tubules (at protein level) (PubMed:16769747, PubMed:29993276). Expressed in the cochlea and endolymphatic sac (PubMed:9916796). {ECO:00
Sequence
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA
QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTG
DILRTPVSED
MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLS
RLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI
FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL
Sequence length 513
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Phagosome
mTOR signaling pathway
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Human papillomavirus infection
Rheumatoid arthritis
  ROS and RNS production in phagocytes
Insulin receptor recycling
Transferrin endocytosis and recycling
Amino acids regulate mTORC1
Ion channel transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Renal Tubular Acidosis, Distal, With Progressive Nerve Deafness Renal tubular acidosis with progressive nerve deafness rs781838938, rs782549406, rs782138777, rs781969081, rs1553420702, rs121964879, rs1553419751, rs782723581, rs145536062, rs121964880, rs782152033, rs121964881, rs1572924733, rs727504746, rs782500780 N/A
Distal Renal Tubular Acidosis distal renal tubular acidosis rs781838938, rs121964880, rs782152033 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
hearing impairment Hearing impairment N/A N/A ClinVar
renal tubular acidosis Renal tubular acidosis N/A N/A ClinVar
Renal Tubular Acidosis with Sensorineural Hearing Loss renal tubular acidosis, distal, 2, with progressive sensorineural hearing loss N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Associate 38447554
Acidosis Renal Tubular Associate 12414817, 12566520, 19478356, 20622307, 23923981, 24252324, 24975934, 25285676, 26208211, 26453614, 26571219, 28188436, 28233610, 29202719, 29627839
View all (7 more)
Breast Neoplasms Associate 33000417
Carcinoma Ovarian Epithelial Associate 36999629
Chromosome Aberrations Associate 26453614
Deafness Associate 12414817
Disease Associate 28233610
Drug Related Side Effects and Adverse Reactions Associate 33000417
Fanconi Syndrome Associate 28188436
Growth Disorders Associate 30230413, 38445406