Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5243
Gene name	ATP binding cassette subfamily B member 1
Gene symbol	ABCB1
Synonyms (NCBI Gene)	ABC20CD243CLCSENPATGP170MDR1P-GPPGY1p-170
Chromosome	7
Chromosome location	7q21.12
Summary	The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

588

Show/Hide all (588)

SNP ID	Visualize variation	Clinical significance	Consequence
rs3842	T>C	Drug-response	3 prime UTR variant
rs17064	T>A	Drug-response	3 prime UTR variant
rs868755	T>A,C,G	Drug-response	Intron variant
rs1016793	G>A	Drug-response	Intron variant
rs1045642	A>C,G,T	Not-provided, drug-response, benign	Missense variant, coding sequence variant, synonymous variant
rs1128501	C>A	Pathogenic	Missense variant, coding sequence variant
rs1128503	A>G	Drug-response, benign	Coding sequence variant, synonymous variant
rs1202168	G>A	Drug-response	Intron variant
rs1202170	C>G,T	Drug-response	Intron variant
rs1211152	A>C,G,T	Drug-response	Intron variant
rs1922240	T>A,C	Drug-response	Intron variant
rs1922242	A>C,T	Drug-response	Intron variant
rs2032582	A>C,T	Not-provided, drug-response, risk-factor, benign	Missense variant, coding sequence variant
rs2032588	G>A	Drug-response	Intron variant
rs2214102	T>A,C,G	Drug-response	Coding sequence variant, 5 prime UTR variant, synonymous variant
rs2214103	C>G	Drug-response	Intron variant
rs2235013	C>A,T	Drug-response	Intron variant
rs2235015	C>A,T	Drug-response, benign	Intron variant
rs2235018	T>C	Drug-response	Intron variant
rs2235019	C>A	Drug-response	Intron variant
rs2235020	T>A,G	Drug-response	Intron variant
rs2235021	C>A	Drug-response	Intron variant
rs2235033	A>G,T	Drug-response	Intron variant
rs2235035	G>A	Drug-response	Intron variant
rs2235046	T>A,C,G	Drug-response	Intron variant
rs2235062	G>A,T	Drug-response	Intron variant
rs2235074	G>A	Drug-response	Intron variant
rs2235075	A>G	Drug-response	Intron variant
rs2888599	C>T	Drug-response	Intron variant
rs3213619	A>G	Drug-response	5 prime UTR variant, intron variant
rs3214119	C>-	Drug-response	Intron variant
rs7809208	A>C	Drug-response	Intron variant
rs9282564	T>A,C,G	Drug-response	Coding sequence variant, missense variant
rs10276036	C>A,T	Drug-response	Intron variant
rs13237132	C>G	Drug-response	Intron variant
rs28381817	T>C	Drug-response	Intron variant
rs28381825	T>C	Drug-response	Intron variant
rs28381827	C>T	Drug-response	Intron variant
rs28381848	T>C	Drug-response	Intron variant
rs28381875	C>T	Drug-response	Intron variant
rs28381877	A>G	Drug-response	Intron variant
rs28381903	C>A	Drug-response	Intron variant
rs28381920	G>A	Drug-response	Intron variant
rs55852620	T>G	Benign, drug-response	Missense variant, coding sequence variant
rs58898486	G>T	Drug-response	Intron variant
rs61040122	G>A	Drug-response	Intron variant
rs61122623	C>T	Drug-response	Missense variant, coding sequence variant
rs115493381	C>A,T	Drug-response	Synonymous variant, coding sequence variant
rs116788440	C>T	Drug-response	Intron variant
rs139611979	C>A,T	Drug-response	Missense variant, coding sequence variant, stop gained
rs141755720	C>A	Drug-response	Intron variant
rs147823195	C>A,T	Drug-response	Coding sequence variant, missense variant
rs192365005	A>C,G	Drug-response	Intron variant
rs199578136	C>T	Drug-response	Missense variant, coding sequence variant
rs199676098	G>A,T	Drug-response	Missense variant, coding sequence variant
rs199779996	C>T	Drug-response	Missense variant, coding sequence variant
rs199939852	T>A	Drug-response	Intron variant
rs200120627	T>A,C	Drug-response	Intron variant
rs200490161	A>C,G	Drug-response	Synonymous variant, coding sequence variant
rs200748388	G>A	Drug-response	5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs201122883	G>A	Drug-response	Missense variant, coding sequence variant
rs201249149	C>A,T	Drug-response	Missense variant, coding sequence variant
rs201280497	C>A,T	Drug-response	Missense variant, coding sequence variant
rs201609930	C>T	Drug-response	Missense variant, coding sequence variant
rs201678613	T>C	Drug-response	Missense variant, coding sequence variant
rs201725784	G>A,T	Drug-response	Missense variant, coding sequence variant
rs202013565	G>A,T	Drug-response	Intron variant
rs202026600	A>G,T	Drug-response	3 prime UTR variant
rs202180045	C>G,T	Drug-response	Intron variant
rs368096241	C>T	Drug-response	Synonymous variant, coding sequence variant
rs373236080	C>A,G,T	Drug-response	Intron variant
rs373789868	C>G,T	Drug-response	Synonymous variant, coding sequence variant
rs377260637	G>A	Drug-response	Intron variant
rs377623963	G>A,T	Drug-response	Intron variant
rs532094830	G>A,C,T	Drug-response	Synonymous variant, missense variant, coding sequence variant
rs539878014	G>A,C,T	Drug-response	Intron variant
rs547093769	A>C,G	Drug-response	Intron variant
rs549753290	G>A,T	Drug-response	3 prime UTR variant
rs565311765	C>T	Drug-response	Intron variant
rs566654614	A>G,T	Drug-response	Intron variant
rs746205498	C>A,G,T	Drug-response	Intron variant
rs746946995	G>C,T	Drug-response	Coding sequence variant, missense variant
rs749904097	A>C,G	Drug-response	3 prime UTR variant
rs750020655	C>A,T	Drug-response	Coding sequence variant, missense variant
rs751270575	G>T	Drug-response	Coding sequence variant, missense variant
rs752103700	C>T	Drug-response	Intron variant
rs753065601	C>T	Drug-response	Coding sequence variant, missense variant
rs754592414	C>T	Drug-response	Intron variant
rs755085099	C>T	Drug-response	Coding sequence variant, missense variant
rs755399685	C>T	Drug-response	Coding sequence variant, synonymous variant
rs756736504	G>A	Drug-response	Coding sequence variant, missense variant
rs756800740	C>T	Drug-response	Coding sequence variant, missense variant
rs756910860	T>A,C	Drug-response	Intron variant
rs757394498	T>C	Drug-response	Coding sequence variant, missense variant
rs758212180	A>C,T	Drug-response	Coding sequence variant, missense variant
rs758454815	A>C,G	Drug-response	Intron variant
rs758834776	C>T	Drug-response	Coding sequence variant, missense variant
rs759177745	C>G,T	Drug-response	Coding sequence variant, missense variant
rs759986853	G>A,C	Drug-response	Coding sequence variant, missense variant
rs761914266	C>A	Drug-response	Coding sequence variant, missense variant
rs762374613	A>G,T	Drug-response	Intron variant
rs762925936	T>C	Drug-response	Intron variant
rs763629745	C>G,T	Drug-response	Intron variant
rs764061195	T>G	Drug-response	Coding sequence variant, missense variant
rs764463583	G>T	Drug-response	Coding sequence variant, missense variant
rs766402999	C>T	Drug-response	Intron variant
rs768893111	C>T	Drug-response	Intron variant
rs769400173	C>G,T	Drug-response	Coding sequence variant, missense variant
rs770657790	C>T	Drug-response	Coding sequence variant, missense variant
rs773338757	C>T	Drug-response	Intron variant
rs776827328	T>C	Drug-response	Coding sequence variant, missense variant
rs778715012	C>A,T	Drug-response	Intron variant
rs779274456	G>C,T	Drug-response	Coding sequence variant, synonymous variant
rs779701045	A>G,T	Drug-response	Intron variant
rs780878256	G>A,C	Drug-response	Intron variant
rs781008688	C>-	Drug-response	3 prime UTR variant
rs887308819	C>T	Drug-response	3 prime UTR variant
rs898222211	G>A,C	Drug-response	Intron variant
rs915714963	T>C,G	Drug-response	Intron variant
rs924572540	C>T	Drug-response	Intron variant
rs928039773	C>T	Drug-response	Intron variant
rs936689901	A>G,T	Drug-response	Intron variant
rs939340150	C>T	Drug-response	Intron variant
rs949343048	A>G	Drug-response	Intron variant
rs957318449	G>A	Drug-response	Missense variant, coding sequence variant
rs962879803	A>G,T	Drug-response	Intron variant
rs982764376	T>A,C	Drug-response	Intron variant
rs987724889	T>C,G	Drug-response	Intron variant
rs989584849	C>A,T	Drug-response	Intron variant
rs1007307351	G>A,C	Drug-response	Intron variant
rs1008523470	G>A	Drug-response	Intron variant
rs1016975479	G>A,C	Drug-response	Intron variant
rs1018001117	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1027598958	G>A,C	Drug-response	Intron variant
rs1031971223	G>A	Drug-response	Coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant, synonymous variant
rs1046963200	C>A,T	Drug-response	Intron variant
rs1049335068	A>C,G	Drug-response	Intron variant
rs1168879904	G>A,T	Drug-response	Coding sequence variant, missense variant
rs1177210906	A>C,T	Drug-response	Intron variant
rs1201355238	T>C,G	Drug-response	3 prime UTR variant
rs1209017436	T>C	Drug-response	Intron variant
rs1215218029	G>A	Drug-response	Intron variant
rs1225969541	G>A,C	Drug-response	Intron variant
rs1229084791	G>A,C	Drug-response	Intron variant
rs1229537494	C>A,T	Drug-response	Intron variant
rs1235811417	T>C,G	Drug-response	Intron variant
rs1239586220	C>A,T	Drug-response	Intron variant
rs1253462004	C>A,T	Drug-response	Coding sequence variant, missense variant
rs1255216813	C>T	Drug-response	Intron variant
rs1259527290	C>T	Drug-response	Coding sequence variant, missense variant
rs1290687132	G>A	Drug-response	Intron variant
rs1291526534	A>T	Drug-response	Intron variant
rs1292455657	C>T	Drug-response	Missense variant, coding sequence variant
rs1297328873	G>A,T	Drug-response	Coding sequence variant, stop gained, synonymous variant
rs1297599774	C>A,T	Drug-response	Intron variant
rs1306027704	G>C,T	Drug-response	Coding sequence variant, missense variant
rs1309545061	T>A,C	Drug-response	Intron variant
rs1317002705	C>A,G	Drug-response	Intron variant
rs1342363724	A>C,G	Drug-response	Intron variant
rs1347885425	GA>-	Drug-response	Intron variant
rs1353988860	C>G,T	Drug-response	Intron variant
rs1354465955	G>T	Drug-response	Intron variant
rs1368229642	C>T	Drug-response	Intron variant
rs1369339362	G>A,T	Drug-response	Intron variant
rs1370607856	C>A	Drug-response	Intron variant
rs1370696292	C>G,T	Drug-response	Intron variant
rs1372487776	C>A,T	Drug-response	Missense variant, coding sequence variant
rs1373455786	C>A,T	Drug-response	Missense variant, coding sequence variant
rs1374940464	C>G,T	Drug-response	Missense variant, coding sequence variant
rs1375773702	C>A,T	Drug-response	Coding sequence variant, synonymous variant
rs1376124155	C>A,G	Drug-response	Intron variant
rs1377795423	C>T	Drug-response	Missense variant, coding sequence variant
rs1380760525	T>C,G	Drug-response	Intron variant
rs1387659216	T>A,C	Drug-response	Intron variant
rs1403432068	G>A	Drug-response	Missense variant, coding sequence variant
rs1410758133	T>A,G	Drug-response	Intron variant
rs1414173164	G>A,C	Drug-response	3 prime UTR variant
rs1415447553	T>C,G	Drug-response	Missense variant, coding sequence variant
rs1421351917	G>A	Drug-response	Stop gained, coding sequence variant
rs1422618705	A>C,T	Drug-response	Intron variant
rs1445722698	T>A,G	Drug-response	Intron variant
rs1455949602	G>A,C	Drug-response	Synonymous variant, coding sequence variant
rs1457191518	A>G,T	Drug-response	Synonymous variant, stop gained, coding sequence variant
rs1459443271	T>C	Drug-response	Intron variant
rs1464634362	A>C,G	Drug-response	Intron variant
rs1465156359	C>G,T	Drug-response	Intron variant
rs1468049509	A>G,T	Drug-response	Intron variant
rs1472049062	C>T	Drug-response	Intron variant
rs1488249711	G>A,T	Drug-response	Intron variant
rs1563045087	C>T	Drug-response	Intron variant
rs1563063804	A>G,T	Drug-response	Intron variant
rs1563063911	C>G,T	Drug-response	Intron variant
rs1584823236	G>A	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823240	A>G	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823244	G>C	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823254	C>T	Drug-response	3 prime UTR variant, downstream transcript variant, genic downstream transcript variant
rs1584823290	T>G	Drug-response	3 prime UTR variant
rs1584823368	A>G	Drug-response	3 prime UTR variant
rs1584823377	A>G	Drug-response	3 prime UTR variant
rs1584823470	T>G	Drug-response	3 prime UTR variant
rs1584823473	T>A	Drug-response	3 prime UTR variant
rs1584823480	C>A	Drug-response	3 prime UTR variant
rs1584823499	G>A	Drug-response	3 prime UTR variant
rs1584823519	C>G	Drug-response	3 prime UTR variant
rs1584823531	C>T	Drug-response	3 prime UTR variant
rs1584823541	T>C	Drug-response	3 prime UTR variant
rs1584823594	C>G	Drug-response	3 prime UTR variant
rs1584823642	T>G	Drug-response	3 prime UTR variant
rs1584823651	C>G	Drug-response	3 prime UTR variant
rs1584823655	T>G	Drug-response	3 prime UTR variant
rs1584823683	T>-	Drug-response	3 prime UTR variant
rs1584823717	A>G	Drug-response	3 prime UTR variant
rs1584823745	G>A	Drug-response	Synonymous variant, coding sequence variant
rs1584823811	A>C	Drug-response	Missense variant, coding sequence variant
rs1584823866	T>C	Drug-response	Missense variant, coding sequence variant
rs1584824009	C>T	Drug-response	Missense variant, coding sequence variant
rs1584824060	A>T	Drug-response	Missense variant, coding sequence variant
rs1584824131	C>T	Drug-response	Missense variant, coding sequence variant
rs1584824153	G>T	Drug-response	Missense variant, coding sequence variant
rs1584824159	A>C	Drug-response	Missense variant, coding sequence variant
rs1584824182	A>C	Drug-response	Intron variant
rs1584826185	A>G	Drug-response	Intron variant
rs1584826310	C>T	Drug-response	Missense variant, coding sequence variant
rs1584826349	C>T	Drug-response	Missense variant, coding sequence variant
rs1584826422	T>G	Drug-response	Missense variant, coding sequence variant
rs1584826433	T>A	Drug-response	Stop gained, coding sequence variant
rs1584826485	G>A	Drug-response	Stop gained, coding sequence variant
rs1584826521	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584826524	G>A	Drug-response	Intron variant
rs1584826607	G>A	Drug-response	Intron variant
rs1584826651	T>G	Drug-response	Intron variant
rs1584829568	C>A	Drug-response	Missense variant, coding sequence variant
rs1584829602	C>T	Drug-response	Missense variant, coding sequence variant
rs1584829608	G>C	Drug-response	Missense variant, coding sequence variant
rs1584829753	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584829851	C>T	Drug-response	Intron variant
rs1584829872	C>T	Drug-response	Intron variant
rs1584834617	A>C	Drug-response	Splice donor variant
rs1584834623	A>C	Drug-response	Missense variant, coding sequence variant
rs1584834796	C>T	Drug-response	Missense variant, coding sequence variant
rs1584834848	A>C	Drug-response	Synonymous variant, coding sequence variant
rs1584834899	T>C	Drug-response	Missense variant, coding sequence variant
rs1584834930	C>T	Drug-response	Missense variant, coding sequence variant
rs1584835033	G>T	Drug-response	Synonymous variant, coding sequence variant
rs1584835130	A>C	Drug-response	Intron variant
rs1584835173	A>G	Drug-response	Intron variant
rs1584835202	C>G,T	Drug-response	Intron variant
rs1584835214	T>A	Drug-response	Intron variant
rs1584835244	T>G	Drug-response	Intron variant
rs1584836629	A>C	Drug-response	Intron variant
rs1584836644	C>A	Drug-response	Intron variant
rs1584836653	A>G	Drug-response	Intron variant
rs1584836737	C>T	Drug-response	Missense variant, coding sequence variant
rs1584840431	T>C	Drug-response	Intron variant
rs1584840436	T>A	Drug-response	Intron variant
rs1584840439	A>T	Drug-response	Intron variant
rs1584840441	G>A	Drug-response	Intron variant
rs1584840613	G>A	Drug-response	Stop gained, coding sequence variant
rs1584840650	A>G	Drug-response	Missense variant, coding sequence variant
rs1584840663	G>T	Drug-response	Intron variant
rs1584840710	G>A	Drug-response	Intron variant
rs1584841757	C>A	Drug-response	Intron variant
rs1584841967	G>A	Drug-response	Intron variant
rs1584841973	A>G	Drug-response	Intron variant
rs1584852928	A>G	Drug-response	Intron variant
rs1584852932	G>A	Drug-response	Intron variant
rs1584853136	A>C	Drug-response	Missense variant, coding sequence variant
rs1584853146	C>T	Drug-response	Missense variant, coding sequence variant
rs1584853152	A>C	Drug-response	Missense variant, coding sequence variant
rs1584857518	C>A	Drug-response	Intron variant
rs1584857539	A>T	Drug-response	Intron variant
rs1584857543	A>C	Drug-response	Intron variant
rs1584857558	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584857640	C>T	Drug-response	Splice acceptor variant
rs1584859774	C>A	Drug-response	Intron variant
rs1584859789	G>C	Drug-response	Intron variant
rs1584859927	C>T	Drug-response	Missense variant, coding sequence variant
rs1584859968	G>C	Drug-response	Intron variant
rs1584860048	A>C	Drug-response	Intron variant
rs1584861751	C>A	Drug-response	Intron variant
rs1584861789	C>A	Drug-response	Splice donor variant
rs1584861846	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584861940	G>A	Drug-response	Missense variant, coding sequence variant
rs1584861948	T>A	Drug-response	Missense variant, coding sequence variant
rs1584861959	C>T	Drug-response	Missense variant, coding sequence variant
rs1584861968	G>A	Drug-response	Missense variant, coding sequence variant
rs1584862080	G>A	Drug-response	Intron variant
rs1584862137	G>A	Drug-response	Intron variant
rs1584862144	C>-	Drug-response	Intron variant
rs1584862188	G>A	Drug-response	Intron variant
rs1584862195	T>-	Drug-response	Intron variant
rs1584864515	G>A	Drug-response	Intron variant
rs1584864525	A>C	Drug-response	Intron variant
rs1584864535	T>G	Drug-response	Intron variant
rs1584864540	C>A	Drug-response	Intron variant
rs1584864555	A>G	Drug-response	Intron variant
rs1584864582	G>A	Drug-response	Intron variant
rs1584864590	C>A	Drug-response	Intron variant
rs1584864714	C>T	Drug-response	Missense variant, coding sequence variant
rs1584864725	C>T	Drug-response	Missense variant, coding sequence variant
rs1584864743	T>A	Drug-response	Missense variant, coding sequence variant
rs1584864863	A>T	Drug-response	Intron variant
rs1584864874	GGA>-	Drug-response	Intron variant
rs1584864880	A>T	Drug-response	Intron variant
rs1584864890	C>A	Drug-response	Intron variant
rs1584864923	T>C	Drug-response	Intron variant
rs1584865238	C>A	Drug-response	Intron variant
rs1584865310	A>C	Drug-response	Intron variant
rs1584865377	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584865847	A>-	Drug-response	Intron variant
rs1584866513	A>G	Drug-response	Intron variant
rs1584866517	T>C	Drug-response	Intron variant
rs1584866531	A>G	Drug-response	Intron variant
rs1584866539	T>C	Drug-response	Intron variant
rs1584866716	T>C	Drug-response	Missense variant, coding sequence variant
rs1584866897	T>-	Drug-response	Intron variant
rs1584867527	T>G	Drug-response	Intron variant
rs1584867530	A>C	Drug-response	Intron variant
rs1584867532	C>A	Drug-response	Intron variant
rs1584867557	A>C	Drug-response	Intron variant
rs1584870154	A>G	Drug-response	Intron variant
rs1584870236	A>T	Drug-response	Intron variant
rs1584870326	A>C	Drug-response	Missense variant, coding sequence variant
rs1584870462	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870522	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870562	C>T	Drug-response	Missense variant, coding sequence variant
rs1584870588	A>G	Drug-response	Intron variant
rs1584870644	A>T	Drug-response	Intron variant
rs1584870717	G>T	Drug-response	Intron variant
rs1584870734	C>T	Drug-response	Intron variant
rs1584870737	T>A	Drug-response	Intron variant
rs1584870744	A>T	Drug-response	Intron variant
rs1584870801	C>T	Drug-response	Intron variant
rs1584870839	A>-	Drug-response	Intron variant
rs1584871120	G>T	Drug-response	Missense variant, coding sequence variant
rs1584871159	C>T	Drug-response	Missense variant, coding sequence variant
rs1584871252	C>-	Drug-response	Intron variant
rs1584871266	TG>-	Drug-response	Intron variant
rs1584871277	C>A	Drug-response	Intron variant
rs1584871295	G>A	Drug-response	Intron variant
rs1584871312	A>G	Drug-response	Intron variant
rs1584871355	G>A	Drug-response	Intron variant
rs1584871437	C>G	Drug-response	Missense variant, coding sequence variant
rs1584871479	T>C	Drug-response	Synonymous variant, coding sequence variant
rs1584871482	G>A	Drug-response	Synonymous variant, coding sequence variant
rs1584871494	T>G	Drug-response	Missense variant, coding sequence variant
rs1584871513	C>A	Drug-response	Missense variant, coding sequence variant
rs1584871572	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584871577	C>T	Drug-response	Missense variant, coding sequence variant
rs1584871582	T>C	Drug-response	Missense variant, coding sequence variant
rs1584871639	T>A	Drug-response	Missense variant, coding sequence variant
rs1584871672	G>A	Drug-response	Intron variant
rs1584871701	A>T	Drug-response	Intron variant
rs1584871706	G>A	Drug-response	Intron variant
rs1584871734	T>G	Drug-response	Intron variant
rs1584871788	C>T	Drug-response	Intron variant
rs1584871842	T>C	Drug-response	Missense variant, coding sequence variant
rs1584871861	G>A	Drug-response	Stop gained, coding sequence variant
rs1584871933	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584871947	A>T	Drug-response	Missense variant, coding sequence variant
rs1584871955	G>A	Drug-response	Missense variant, coding sequence variant
rs1584872123	C>T	Drug-response	Intron variant
rs1584872136	A>-	Drug-response	Intron variant
rs1584872141	G>T	Drug-response	Intron variant
rs1584872146	G>-	Drug-response	Intron variant
rs1584872159	A>G	Drug-response	Intron variant
rs1584872191	A>T	Drug-response	Intron variant
rs1584872207	G>A	Drug-response	Intron variant
rs1584872301	A>T	Drug-response	Missense variant, coding sequence variant
rs1584872342	T>G	Drug-response	Synonymous variant, coding sequence variant
rs1584872360	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584872372	C>T	Drug-response	Missense variant, coding sequence variant
rs1584872523	A>-	Drug-response	Intron variant
rs1584875156	T>G	Drug-response	Intron variant
rs1584875166	T>C	Drug-response	Intron variant
rs1584875299	C>T	Drug-response	Missense variant, coding sequence variant
rs1584875420	A>T	Drug-response	Missense variant, coding sequence variant
rs1584875429	C>T	Drug-response	Missense variant, coding sequence variant
rs1584875546	T>G	Drug-response	Intron variant
rs1584875572	G>A	Drug-response	Intron variant
rs1584875617	A>G	Drug-response	Intron variant
rs1584875679	G>A	Drug-response	Intron variant
rs1584875690	C>-	Drug-response	Intron variant
rs1584875732	G>A	Drug-response	Intron variant
rs1584875845	A>C	Drug-response	Intron variant
rs1584876051	G>A	Drug-response	Intron variant
rs1584876122	G>T	Drug-response	Intron variant
rs1584876165	T>A	Drug-response	Intron variant
rs1584876196	T>C	Drug-response	Intron variant
rs1584876204	G>T	Drug-response	Intron variant
rs1584876354	A>C	Drug-response	Intron variant
rs1584880914	G>A	Drug-response	Intron variant
rs1584880919	T>C	Drug-response	Intron variant
rs1584881029	C>G	Drug-response	Intron variant
rs1584881050	A>C	Drug-response	Intron variant
rs1584881055	T>A	Drug-response	Intron variant
rs1584881535	G>C	Drug-response	Intron variant
rs1584881586	A>-	Drug-response	Intron variant
rs1584881633	C>T	Drug-response	Missense variant, coding sequence variant
rs1584881689	A>C	Drug-response	Missense variant, coding sequence variant
rs1584881716	A>G	Drug-response	Synonymous variant, coding sequence variant
rs1584881721	C>T	Drug-response	Missense variant, coding sequence variant
rs1584882616	T>C	Drug-response	Intron variant
rs1584882620	C>T	Drug-response	Intron variant
rs1584882625	T>C	Drug-response	Intron variant
rs1584882718	C>A	Drug-response	Intron variant
rs1584882723	A>T	Drug-response	Intron variant
rs1584885500	A>G	Drug-response	Intron variant
rs1584885509	T>C	Drug-response	Intron variant
rs1584885551	A>C	Drug-response	Intron variant
rs1584885852	G>A	Drug-response	Intron variant
rs1584885927	C>T	Drug-response	Intron variant
rs1584886037	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886062	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886072	A>C	Drug-response	Missense variant, coding sequence variant
rs1584886173	A>G	Drug-response	Intron variant
rs1584886228	A>G	Drug-response	Intron variant
rs1584886384	T>A	Drug-response	Intron variant
rs1584886392	T>C	Drug-response	Intron variant
rs1584886492	C>T	Drug-response	Intron variant
rs1584886587	T>-	Drug-response	Intron variant
rs1584886661	C>T	Drug-response	Intron variant
rs1584886694	G>-	Drug-response	Coding sequence variant, frameshift variant
rs1584886735	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584886768	C>T	Drug-response	Missense variant, coding sequence variant
rs1584886787	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584886875	C>A	Drug-response	Synonymous variant, coding sequence variant
rs1584886962	T>A	Drug-response	Missense variant, coding sequence variant
rs1584886995	A>-	Drug-response	Intron variant
rs1584887050	C>A	Drug-response	Intron variant
rs1584887226	G>A	Drug-response	Intron variant
rs1584887273	A>T	Drug-response	Intron variant
rs1584887296	G>T	Drug-response	Intron variant
rs1584887312	A>T	Drug-response	Intron variant
rs1584887315	A>G,T	Drug-response	Intron variant
rs1584887330	A>T	Drug-response	Intron variant
rs1584887344	C>-	Drug-response	Intron variant
rs1584887358	A>-	Drug-response	Intron variant
rs1584887366	T>-	Drug-response	Intron variant
rs1584889692	G>A	Drug-response	Intron variant
rs1584889697	G>T	Drug-response	Intron variant
rs1584889701	C>T	Drug-response	Intron variant
rs1584889708	C>A	Drug-response	Intron variant
rs1584889711	A>T	Drug-response	Intron variant
rs1584889722	A>C	Drug-response	Intron variant
rs1584889733	T>G	Drug-response	Intron variant
rs1584889745	A>C	Drug-response	Intron variant
rs1584889754	C>T	Drug-response	Intron variant
rs1584889859	G>T	Drug-response	Intron variant
rs1584889905	A>G	Drug-response	Intron variant
rs1584889940	C>A	Drug-response	Intron variant
rs1584889961	T>G	Drug-response	Intron variant
rs1584890095	C>A	Drug-response	Stop gained, coding sequence variant
rs1584890130	G>A	Drug-response	Missense variant, coding sequence variant
rs1584890268	G>A	Drug-response	Intron variant
rs1584890282	A>G	Drug-response	Intron variant
rs1584890294	G>A	Drug-response	Intron variant
rs1584901639	A>C	Drug-response	Intron variant
rs1584901651	A>G	Drug-response	Intron variant
rs1584901654	A>C	Drug-response	Intron variant
rs1584901803	C>-	Drug-response	Intron variant
rs1584901860	C>T	Drug-response	Intron variant
rs1584901891	T>C	Drug-response	Intron variant
rs1584901896	G>A	Drug-response	Intron variant
rs1584901920	G>T	Drug-response	Intron variant
rs1584901951	A>T	Drug-response	Intron variant
rs1584901984	T>C	Drug-response	Intron variant
rs1584901992	T>C	Drug-response	Intron variant
rs1584901996	A>G	Drug-response	Intron variant
rs1584902000	G>C	Drug-response	Intron variant
rs1584902074	T>C	Drug-response	Intron variant
rs1584902150	C>A	Drug-response	Intron variant
rs1584902180	A>G	Drug-response	Intron variant
rs1584902204	G>A	Drug-response	Intron variant
rs1584902218	G>T	Drug-response	Intron variant
rs1584902264	T>-	Drug-response	Intron variant
rs1584902271	C>T	Drug-response	Intron variant
rs1584902336	C>T	Drug-response	Missense variant, coding sequence variant
rs1584902348	C>T	Drug-response	Synonymous variant, coding sequence variant
rs1584902369	C>T	Drug-response	Missense variant, coding sequence variant
rs1584902411	AG>-	Drug-response	Coding sequence variant, frameshift variant
rs1584902425	G>A	Drug-response	Missense variant, coding sequence variant
rs1584902437	C>A	Drug-response	Missense variant, coding sequence variant
rs1584902466	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584902579	A>G	Drug-response	Synonymous variant, coding sequence variant
rs1584902591	A>-	Drug-response	Intron variant
rs1584902609	A>-	Drug-response	Intron variant
rs1584902619	G>-	Drug-response	Intron variant
rs1584902756	A>T	Drug-response	Intron variant
rs1584910469	A>G	Drug-response	Intron variant
rs1584910473	G>A	Drug-response	Intron variant
rs1584910478	T>C	Drug-response	Intron variant
rs1584910554	C>T	Drug-response	Intron variant
rs1584910566	A>T	Drug-response	Intron variant
rs1584910621	C>G	Drug-response	Intron variant
rs1584910858	C>G	Drug-response	Intron variant
rs1584910872	T>G	Drug-response	Intron variant
rs1584910875	T>C	Drug-response	Intron variant
rs1584910879	A>C	Drug-response	Intron variant
rs1584910893	T>A	Drug-response	Intron variant
rs1584910898	T>A	Drug-response	Intron variant
rs1584910901	G>T	Drug-response	Intron variant
rs1584910904	T>A	Drug-response	Intron variant
rs1584910912	T>A	Drug-response	Intron variant
rs1584910920	T>A,C	Drug-response	Intron variant
rs1584910934	C>T	Drug-response	Intron variant
rs1584910945	T>C	Drug-response	Intron variant
rs1584910949	C>T	Drug-response	Intron variant
rs1584910952	T>C	Drug-response	Intron variant
rs1584910957	C>T	Drug-response	Intron variant
rs1584910973	C>T	Drug-response	Intron variant
rs1584911001	T>C	Drug-response	Intron variant
rs1584911038	C>-	Drug-response	Intron variant
rs1584911058	G>C	Drug-response	Intron variant
rs1584911161	A>C	Drug-response	Missense variant, coding sequence variant
rs1584911169	A>T	Drug-response	Synonymous variant, coding sequence variant
rs1584911173	G>A	Drug-response	Missense variant, coding sequence variant
rs1584911190	C>-	Drug-response	Coding sequence variant, frameshift variant
rs1584911230	A>C	Drug-response	Intron variant
rs1584911242	A>C	Drug-response	Intron variant
rs1584911245	A>C	Drug-response	Intron variant
rs1584911250	A>C	Drug-response	Intron variant
rs1584911254	A>C	Drug-response	Intron variant
rs1584911259	A>C	Drug-response	Intron variant
rs1584911271	A>C	Drug-response	Intron variant
rs1584911278	A>C	Drug-response	Intron variant
rs1584911288	A>C	Drug-response	Intron variant
rs1584911315	A>T	Drug-response	Intron variant
rs1584911850	A>G	Drug-response	Intron variant
rs1584911855	A>G	Drug-response	Intron variant
rs1584911860	C>T	Drug-response	Intron variant
rs1584911866	T>C	Drug-response	Intron variant
rs1584911872	G>A	Drug-response	Intron variant
rs1584911877	C>T	Drug-response	Intron variant
rs1584912048	C>G	Drug-response	Intron variant
rs1584913947	T>G	Drug-response	Intron variant
rs1584913955	T>A	Drug-response	Intron variant
rs1584913959	G>A	Drug-response	Intron variant
rs1584913965	A>T	Drug-response	Intron variant
rs1584913986	A>T	Drug-response	Intron variant
rs1584914074	G>T	Drug-response	Intron variant
rs1584914222	T>A	Drug-response	Intron variant
rs1584914264	A>T	Drug-response	Intron variant
rs1584914268	A>C	Drug-response	Intron variant
rs1584914270	A>G	Drug-response	Intron variant
rs1584914289	C>T	Drug-response	Splice donor variant
rs1584914478	T>G	Drug-response	Intron variant
rs1584914521	G>T	Drug-response	Intron variant
rs1584914617	G>A	Drug-response	Intron variant
rs1584914629	G>A	Drug-response	Intron variant
rs1584914719	T>G	Drug-response	Intron variant
rs1584914842	T>G	Drug-response	Intron variant
rs1584914908	T>C	Drug-response	Intron variant
rs1584914912	T>C	Drug-response	Intron variant
rs1584914920	C>T	Drug-response	Intron variant
rs1584914926	T>C	Drug-response	Intron variant
rs1584914929	A>G	Drug-response	Intron variant
rs1584914931	G>A	Drug-response	Intron variant
rs1584914953	T>C	Drug-response	Intron variant
rs1584914976	C>T	Drug-response	Intron variant
rs1584915016	G>A	Drug-response	Intron variant
rs1584915038	G>A	Drug-response	Intron variant
rs1584915041	G>A	Drug-response	Intron variant
rs1584915050	T>A	Drug-response	5 prime UTR variant, missense variant, coding sequence variant
rs1584915094	A>C	Drug-response	5 prime UTR variant, intron variant
rs1584915124	C>T	Drug-response	5 prime UTR variant, intron variant
rs1584915134	C>A	Drug-response	5 prime UTR variant, intron variant
rs1584915145	A>G	Drug-response	5 prime UTR variant, intron variant
rs1584915173	T>C	Drug-response	5 prime UTR variant, intron variant
rs1584915238	G>A	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915251	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915278	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915282	G>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915287	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915300	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915306	G>A	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915309	C>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915313	A>T	Drug-response	5 prime UTR variant, upstream transcript variant, intron variant, genic upstream transcript variant
rs1584915332	A>G	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915353	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915357	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915362	C>A	Drug-response	Stop gained, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915370	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915387	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915392	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915394	G>A	Drug-response	Stop gained, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915409	G>A	Drug-response	Synonymous variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs1584915415	G>A	Drug-response	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005656	hsa-miR-451a	qRT-PCRLuciferase reporter assayWestern blot	18645025
MIRT054152	hsa-miR-129-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25344911
MIRT054152	hsa-miR-129-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25344911
MIRT054158	hsa-miR-508-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23893241
MIRT054158	hsa-miR-508-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23893241
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT438673	hsa-miR-223-3p	GFP reporter assayqRT-PCRWestern blot	23925649
MIRT731564	hsa-miR-186-5p	Luciferase reporter assay	26626440
MIRT731564	hsa-miR-186-5p	Luciferase reporter assay	26626440
MIRT054152	hsa-miR-129-5p	Luciferase reporter assayqRT-PCRWestern blot	28012924
MIRT054152	hsa-miR-129-5p	Luciferase reporter assayqRT-PCRWestern blot	28012924
MIRT733751	hsa-miR-214-3p	Luciferase reporter assayqRT-PCRWestern blotting	32095078
MIRT733751	hsa-miR-214-3p	Luciferase reporter assayWestern blottingqRT-PCR	32095078
MIRT755917	hsa-miR-224-5p	Luciferase reporter assayWestern blottingqRT-PCR	35426328
MIRT758129	hsa-miR-223	CLIP-seq
MIRT758130	hsa-miR-3153	CLIP-seq
MIRT758131	hsa-miR-455-3p	CLIP-seq
MIRT758132	hsa-miR-4668-5p	CLIP-seq
MIRT758133	hsa-miR-582-5p	CLIP-seq
MIRT758134	hsa-miR-935	CLIP-seq

Show/Hide all (40)

Transcription factor	Regulation	Reference
CDX2	Unknown	20699370
CEBPB	Activation	15044620
E2F1	Activation	23542036
EAPP	Activation	23542036
EGR1	Activation	11488907;7565762
EGR1	Unknown	10392899;10860921
EP300	Unknown	22154511
ETS1	Activation	20392592
HDAC1	Repression	19435809;20037778
HDAC1	Unknown	20037778
HIF1A	Repression	12067980
HIPK2	Unknown	20646448
HSF1	Unknown	10816597
JUN	Activation	10369069
MBD1	Unknown	17667922
MECP2	Unknown	11865062
MYCN	Repression	7923112
NFKB1	Activation	19763573
NFKB1	Repression	12527911
NFKB1	Unknown	18234965
NFYA	Unknown	18234965;22154511
NFYB	Unknown	18234965
NFYC	Unknown	18234965
NR1I2	Activation	18540626
PITX2	Unknown	23354914
RELA	Activation	19763573
RELA	Unknown	18234965
SIRT1	Activation	20713551
SP1	Activation	10644769;7565762
SP1	Unknown	10860921;8103518
TCF4	Activation	20459685
TCF7L2	Unknown	10987283
TP53	Repression	10029407
TP53	Unknown	18234965
UHRF1	Repression	20037778
WT1	Unknown	10392899;10860921
YBX1	Activation	10644769
YBX1	Repression	17072343
YBX1	Unknown	18234965
ZNRD1	Activation	16373708

123

Show/Hide all (123)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19384922
GO:0000166	Function	Nucleotide binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001890	Process	Placenta development	IEA
GO:0005515	Function	Protein binding	IPI	17088979, 20711237
GO:0005524	Function	ATP binding	IDA	28757552, 29371429
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	3768958
GO:0005737	Component	Cytoplasm	IDA	35970996
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	18619525, 23137377, 35970996
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	26850595, 28757552
GO:0008559	Function	ABC-type xenobiotic transporter activity	IEA
GO:0008559	Function	ABC-type xenobiotic transporter activity	IGI	23893241, 28260112
GO:0008559	Function	ABC-type xenobiotic transporter activity	IMP	28411377
GO:0008559	Function	ABC-type xenobiotic transporter activity	TAS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	TAS	3022150
GO:0009914	Process	Hormone transport	IEA
GO:0009986	Component	Cell surface	IDA	19384922
GO:0010046	Process	Response to mycotoxin	IEA
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	26850595, 28587984, 28757552
GO:0015562	Function	Efflux transmembrane transporter activity	IGI	23893241, 28260112
GO:0015562	Function	Efflux transmembrane transporter activity	IMP	25986174, 28411377
GO:0016020	Component	Membrane	IDA	26006083
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3022150, 3768958
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	8898203, 16361082, 28408210, 31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0022857	Function	Transmembrane transporter activity	ISS
GO:0031526	Component	Brush border membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	26006083
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0035633	Process	Maintenance of blood-brain barrier	IEA
GO:0036146	Process	Cellular response to mycotoxin	IEA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IBA
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IDA	28757552
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	TAS	3022150
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IBA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	28587984, 28757552
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	25986174
GO:0043215	Process	Daunorubicin transport	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0045332	Process	Phospholipid translocation	IBA
GO:0045332	Process	Phospholipid translocation	IDA	8898203
GO:0045332	Process	Phospholipid translocation	IEA
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046865	Process	Terpenoid transport	ISS
GO:0046943	Function	Carboxylic acid transmembrane transporter activity	IMP	25986174
GO:0050892	Process	Intestinal absorption	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0060856	Process	Establishment of blood-brain barrier	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070633	Process	Transepithelial transport	IDA	28757552
GO:0070633	Process	Transepithelial transport	IMP	25986174
GO:0071217	Process	Cellular response to external biotic stimulus	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071236	Process	Cellular response to antibiotic	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071475	Process	Cellular hyperosmotic salinity response	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0072089	Process	Stem cell proliferation	IMP	19384922
GO:0090554	Function	Phosphatidylcholine floppase activity	IBA
GO:0090554	Function	Phosphatidylcholine floppase activity	IDA	8898203
GO:0090554	Function	Phosphatidylcholine floppase activity	IEA
GO:0090555	Function	Phosphatidylethanolamine flippase activity	IDA	8898203
GO:0097068	Process	Response to thyroxine	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0097327	Process	Response to antineoplastic agent	IEA
GO:0098591	Component	External side of apical plasma membrane	ISS	18619525
GO:0099038	Function	Ceramide floppase activity	IDA	8898203
GO:0099040	Process	Ceramide translocation	IBA
GO:0099040	Process	Ceramide translocation	IDA	8898203
GO:0140115	Process	Export across plasma membrane	IDA	28587984
GO:0140115	Process	Export across plasma membrane	IMP	25986174
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	IEA
GO:0140328	Function	Floppase activity	IMP	8898203
GO:0140359	Function	ABC-type transporter activity	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1902065	Process	Response to L-glutamate	IEA
GO:1902396	Process	Protein localization to bicellular tight junction	IEA
GO:1903416	Process	Response to glycoside	IEA
GO:1904057	Process	Negative regulation of sensory perception of pain	IEA
GO:1904148	Process	Cellular response to nonylphenol	IEA
GO:1904446	Process	Positive regulation of establishment of Sertoli cell barrier	IEA
GO:1904478	Process	Regulation of intestinal absorption	IEA
GO:1905039	Process	Carboxylic acid transmembrane transport	IMP	25986174
GO:1905231	Process	Cellular response to borneol	IEA
GO:1905232	Process	Cellular response to L-glutamate	IEA
GO:1905233	Process	Response to codeine	IEA
GO:1905235	Process	Response to quercetin	IEA
GO:1905237	Process	Response to cyclosporin A	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IDA	26850595
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IEA
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IGI	23893241
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IMP	28260112, 28411377
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	TAS	25344911
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IC	28757552
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IEA
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IMP	25986174
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	ISS	28587984
GO:1990963	Process	Establishment of blood-retinal barrier	IEA
GO:2001025	Process	Positive regulation of response to drug	IEA
GO:2001225	Process	Regulation of chloride transport	IMP	7828597

MIM	HGNC	e!Ensembl
171050	40	ENSG00000085563

P08183

Protein name

ATP-dependent translocase ABCB1 (ATP-binding cassette sub-family B member 1) (Multidrug resistance protein 1) (EC 7.6.2.2) (P-glycoprotein 1) (Phospholipid transporter ABCB1) (EC 7.6.2.1) (CD antigen CD243)

Protein function

Translocates drugs and phospholipids across the membrane (PubMed:2897240, PubMed:35970996, PubMed:8898203, PubMed:9038218, PubMed:35507548). Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membran

PDB

6C0V , 6FN1 , 6FN4 , 6QEX , 7A65 , 7A69 , 7A6C , 7A6E , 7A6F , 7O9W , 8Y6H , 8Y6I , 9CR8 , 9CTC , 9CTF , 9CTG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00664	ABC_membrane	51 → 343	ABC transporter transmembrane region	Family
PF00005	ABC_tran	410 → 559	ABC transporter	Domain
PF00664	ABC_membrane	711 → 986	ABC transporter transmembrane region	Family
PF00005	ABC_tran	1053 → 1204	ABC transporter	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in small intestine (PubMed:28408210). Expressed in liver, kidney and brain. {ECO:0000269|PubMed:28408210}.

Sequence

MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ

Sequence length

1280

Interactions

View interactions

	KEGG		Reactome
	ABC transporters Bile secretion MicroRNAs in cancer Gastric cancer		ABC-family proteins mediated transport

659

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
COLCHICINE RESISTANCE	Pathogenic	rs1128501	RCV000014697
Idiopathic generalized epilepsy	Likely pathogenic	rs2117129739	RCV001509550

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ABCB1-related disorder	Benign; Likely benign; drug response; Uncertain significance	rs2032582, rs2229109, rs1128503, rs1045642, rs2229107, rs41309222, rs200469824, rs201859423, rs138422716, rs35265821, rs187910292, rs1817775401, rs2546975818, rs28381801, rs149482536 View all (7 more)	RCV003975192 RCV003982909 RCV003975269 RCV003975274 RCV003977583 RCV003921902 RCV003974131 RCV003974264 RCV003952218 RCV003914435 RCV003937123 RCV003951450 RCV003926783 RCV003956778 RCV003981885 RCV003971713 RCV003960746 RCV003933122 RCV004758095 RCV003932988 RCV003960490 RCV003953432 RCV003973031
Acute myeloid leukemia	Benign	rs2032582	RCV005888372
Clear cell carcinoma of kidney	Benign	rs2032582	RCV005888373
Colon adenocarcinoma	Likely benign	rs2229107	RCV005938690
Gastric cancer	Likely benign	rs2229107	RCV005938693
Hepatocellular carcinoma	drug response	rs2235046	RCV005912404
Hereditary breast ovarian cancer syndrome	Uncertain significance	rs773597757	RCV001374561
Inflammatory bowel disease 13	Uncertain significance; Benign	rs200823786, rs202002337, rs2032582, rs199676098	RCV001335478 RCV001334606 RCV000014698 RCV002282429
Lung cancer	Benign	rs2032582	RCV005888377
Malignant tumor of esophagus	Likely benign	rs2229107	RCV005938691
MDR1 POLYMORPHISM	Benign	rs1045642	RCV000014699
Melanoma	Likely benign	rs2229107	RCV005938694
Ovarian serous cystadenocarcinoma	Benign	rs2032582	RCV005888375
Sarcoma	Benign; Likely benign	rs2032582, rs2229107	RCV005888374 RCV005938692
Thymoma	Benign	rs2032582	RCV005888376
Tramadol response	Benign; Conflicting classifications of pathogenicity; drug response; Uncertain significance; Likely benign	rs2032582, rs1128503, rs1045642, rs2235015, rs55852620, rs1584823236, rs1584823240, rs1584823244, rs1584823254, rs887308819, rs1584823290, rs1414173164, rs1584823368, rs1584823377, rs549753290 View all (595 more)	RCV001028649 RCV001029394 RCV001029504 RCV001029311 RCV001029497 RCV001029531 RCV001029530 RCV001029529 RCV001029528 RCV001029527 RCV001029526 RCV001029525 RCV001029524 RCV001029523 RCV001029522 RCV001029521 RCV001029520 RCV001028706 RCV001028704 RCV001028705 RCV001028703 RCV001028702 RCV001028701 RCV001028700 RCV001028699 RCV001028698 RCV001028697 RCV001028696 RCV001028695 RCV001028694 RCV001028693 RCV001028692 RCV001028691 RCV001029519 RCV001029518 RCV001029517 RCV001029516 RCV001029515 RCV001029514 RCV001029513 RCV001029512 RCV001029511 RCV001029510 RCV001029509 RCV001029508 RCV001029507 RCV001029506 RCV001029505 RCV001028690 RCV001028689 RCV001028688 RCV001028687 RCV001028686 RCV001028685 RCV001028684 RCV001028683 RCV001028682 RCV001028681 RCV001028680 RCV001028679 RCV001028678 RCV001028677 RCV001028676 RCV001029503 RCV001029502 RCV001029501 RCV001029500 RCV001029499 RCV001029498 RCV001029496 RCV001029495 RCV001029494 RCV001029493 RCV001029492 RCV001029491 RCV001029490 RCV001029489 RCV001028675 RCV001028674 RCV001028673 RCV001028672 RCV001028671 RCV001028670 RCV001028669 RCV001028668 RCV001028667 RCV001028666 RCV001028665 RCV001028664 RCV001028663 RCV001028662 RCV001028661 RCV001028660 RCV001029488 RCV001029487 RCV001029486 RCV001029485 RCV001029484 RCV001029483 RCV001029482 RCV001029481 RCV001029480 RCV001029479 RCV001029478 RCV001029477 RCV001029476 RCV001029475 RCV001029474 RCV001029473 RCV001028659 RCV001028658 RCV001028657 RCV001028656 RCV001028655 RCV001028654 RCV001028653 RCV001028652 RCV001028651 RCV001028650 RCV001028648 RCV001028647 RCV001028646 RCV001028645 RCV001028644 RCV001029472 RCV001029471 RCV001029470 RCV001029469 RCV001029467 RCV001029465 RCV001029463 RCV001029461 RCV001029459 RCV001029457 RCV001029455 RCV001029453 RCV001029452 RCV001029451 RCV001029450 RCV001029449 RCV001028643 RCV001028642 RCV001028641 RCV001028640 RCV001028639 RCV001028638 RCV001028637 RCV001028636 RCV001028635 RCV001028634 RCV001028633 RCV001028632 RCV001028631 RCV001028630 RCV001028629 RCV001028628 RCV001029448 RCV001029447 RCV001029446 RCV001029445 RCV001029444 RCV001029443 RCV001029442 RCV001029441 RCV001029440 RCV001029438 RCV001029436 RCV001029434 RCV001029432 RCV001029431 RCV001029430 RCV001028627 RCV001028626 RCV001028625 RCV001028624 RCV001028623 RCV001028622 RCV001028621 RCV001028620 RCV001028619 RCV001028618 RCV001028617 RCV001028616 RCV001028615 RCV001028614 RCV001028613 RCV001029429 RCV001029428 RCV001029427 RCV001029426 RCV001029425 RCV001029424 RCV001029423 RCV001029422 RCV001029421 RCV001029420 RCV001029419 RCV001029418 RCV001029417 RCV001029416 RCV001029415 RCV001029414 RCV001028612 RCV001028611 RCV001028610 RCV001028609 RCV001028608 RCV001028607 RCV001028606 RCV001028605 RCV001028604 RCV001028603 RCV001028602 RCV001028601 RCV001028600 RCV001028599 RCV001028598 RCV001028597 RCV001029413 RCV001029412 RCV001029411 RCV001029410 RCV001029409 RCV001029408 RCV001029407 RCV001029406 RCV001029405 RCV001029404 RCV001029403 RCV001029402 RCV001029401 RCV001029400 RCV001029399 RCV001029398 RCV001028596 RCV001028595 RCV001028594 RCV001028593 RCV001028592 RCV001028591 RCV001028590 RCV001028589 RCV001028588 RCV001028587 RCV001028586 RCV001028585 RCV001028584 RCV001028583 RCV001028582 RCV001028581 RCV001029397 RCV001029396 RCV001029395 RCV001029393 RCV001029392 RCV001029391 RCV001029390 RCV001029389 RCV001029388 RCV001029387 RCV001029386 RCV001029385 RCV001029384 RCV001029383 RCV001028580 RCV001028579 RCV001028578 RCV001028577 RCV001028576 RCV001028575 RCV001028574 RCV001028573 RCV001028572 RCV001028571 RCV001028570 RCV001028569 RCV001028568 RCV001028567 RCV001028566 RCV001029382 RCV001029381 RCV001029380 RCV001029379 RCV001029378 RCV001029377 RCV001029376 RCV001029375 RCV001029374 RCV001029373 RCV001029372 RCV001029371 RCV001029370 RCV001029369 RCV001029368 RCV001029367 RCV001028565 RCV001028564 RCV001028563 RCV001028562 RCV001028561 RCV001028560 RCV001028559 RCV001028558 RCV001028557 RCV001028556 RCV001028555 RCV001028554 RCV001028553 RCV001028552 RCV001028551 RCV001028550 RCV001029366 RCV001029365 RCV001029364 RCV001029363 RCV001029362 RCV001029361 RCV001029360 RCV001029359 RCV001029358 RCV001029357 RCV001029356 RCV001029355 RCV001029354 RCV001029353 RCV001029352 RCV001029351 RCV001028549 RCV001028548 RCV001028547 RCV001028546 RCV001028545 RCV001028544 RCV001028543 RCV001028542 RCV001028541 RCV001028540 RCV001028539 RCV001028538 RCV001028537 RCV001028536 RCV001028535 RCV001028534 RCV001029350 RCV001029349 RCV001029348 RCV001029347 RCV001029346 RCV001029345 RCV001029344 RCV001029343 RCV001029342 RCV001029341 RCV001029340 RCV001029339 RCV001029338 RCV001029337 RCV001029336 RCV001028533 RCV001028532 RCV001028531 RCV001028530 RCV001028529 RCV001028528 RCV001028527 RCV001028526 RCV001028525 RCV001028524 RCV001028523 RCV001028522 RCV001028521 RCV001028520 RCV001028519 RCV001028518 RCV001029335 RCV001029334 RCV001029333 RCV001029332 RCV001029331 RCV001029330 RCV001029329 RCV001029328 RCV001029327 RCV001029326 RCV001029325 RCV001029324 RCV001029323 RCV001029322 RCV001029321 RCV001029320 RCV001028517 RCV001028516 RCV001028515 RCV001028514 RCV001028513 RCV001028512 RCV001028511 RCV001028510 RCV001028509 RCV001028508 RCV001028507 RCV001028506 RCV001028505 RCV001028504 RCV001029319 RCV001029318 RCV001029317 RCV001029316 RCV001029315 RCV001029314 RCV001029313 RCV001029312 RCV001029310 RCV001029309 RCV001029308 RCV001029307 RCV001029306 RCV001029305 RCV001028503 RCV001028502 RCV001028501 RCV001028500 RCV001028499 RCV001028498 RCV001028497 RCV001028496 RCV001028495 RCV001028494 RCV001028493 RCV001028492 RCV001028491 RCV001028490 RCV001028489 RCV001028488 RCV001029304 RCV001029303 RCV001029302 RCV001029301 RCV001029300 RCV001029299 RCV001029298 RCV001029297 RCV001029296 RCV001029295 RCV001029294 RCV001029293 RCV001029292 RCV001029291 RCV001029290 RCV001029289 RCV001028487 RCV001028486 RCV001028485 RCV001028484 RCV001028483 RCV001028482 RCV001028481 RCV001028480 RCV001028479 RCV001028478 RCV001028477 RCV001028476 RCV001028475 RCV001028474 RCV001028473 RCV001028472 RCV001029288 RCV001029287 RCV001029286 RCV001029285 RCV001029284 RCV001029283 RCV001029282 RCV001029281 RCV001029280 RCV001029279 RCV001029278 RCV001029277 RCV001029276 RCV001029275 RCV001029274 RCV001029273 RCV001028471 RCV001028470 RCV001028469 RCV001028468 RCV001028467 RCV001028466 RCV001028465 RCV001028464 RCV001028463 RCV001028462 RCV001028461 RCV001028460 RCV001028459 RCV001028458 RCV001028457 RCV001028456 RCV001029272 RCV001029271 RCV001029270 RCV001029269 RCV001029268 RCV001029267 RCV001029266 RCV001029265 RCV001029264 RCV001029263 RCV001029262 RCV001029261 RCV001029260 RCV001029259 RCV001029258 RCV001029257 RCV001028455 RCV001028454 RCV001028453 RCV001028452 RCV001028451 RCV001028450 RCV001028449 RCV001028448 RCV001028447 RCV001028446 RCV001028445 RCV001028444 RCV001028443 RCV001028442 RCV001028441 RCV001028440 RCV001029256 RCV001029255 RCV001029254 RCV001029253 RCV001029252 RCV001029251 RCV001029250 RCV001029249 RCV001029248 RCV001029247 RCV001029246 RCV001029245 RCV001029244 RCV001029243 RCV001029242 RCV001028439 RCV001028438 RCV001028437 RCV001028436 RCV001028435 RCV001028434 RCV001028433 RCV001028432 RCV001028431 RCV001028430 RCV001028429 RCV001028428 RCV001028427 RCV001028426 RCV001028425 RCV001028424 RCV001029241 RCV001029240 RCV001029239 RCV001029238 RCV001029237 RCV001029236 RCV001029235 RCV001029234 RCV001029233 RCV001029232 RCV001029231 RCV001029230 RCV001029229 RCV001029228 RCV001029227 RCV001029226 RCV001028423 RCV001028422 RCV001028421 RCV001028420 RCV001028419 RCV001028418 RCV001028417 RCV001028416 RCV001028415 RCV001028414 RCV001028413 RCV001028412 RCV001028411 RCV001028410 RCV001028409 RCV001028408 RCV001029225 RCV001029224 RCV001029223 RCV001029222 RCV001029221 RCV001029220 RCV001029219 RCV001029218 RCV001029217 RCV001029216 RCV001029215 RCV001029214 RCV001029213 RCV001029212 RCV001029211 RCV001029210 RCV001028407
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs2032582, rs2229107	RCV005888378 RCV005938695

Show/Hide Text Mining Associations (412)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	39394110
Abdominal Pain	Associate	23828747
Acquired Immunodeficiency Syndrome	Associate	18391751, 20531015, 23372834
Acute Coronary Syndrome	Associate	29936693, 31778598
Acute Kidney Injury	Associate	28792917
Adenocarcinoma	Associate	16107775, 21636699, 26404133, 26632382, 27600491, 28081737, 34065402, 8543635, 8766529
Adenocarcinoma	Stimulate	25964055
Adenocarcinoma Bronchiolo Alveolar	Associate	19484794
Adenocarcinoma Clear Cell	Stimulate	14675314
Adenocarcinoma of Lung	Associate	19107762, 27995666, 29768255, 34066059
Adenoma	Associate	19250544, 23977225, 36411191
Adrenocortical Carcinoma	Associate	12015757
Agranulocytosis	Associate	17683514
AIDS Associated Nephropathy	Associate	14525546
AIDS related Kaposi sarcoma	Associate	21829205
Alcoholism	Associate	25918995
Alopecia	Associate	32756886
Alzheimer Disease	Associate	15975076, 17617464, 21478475, 21718295, 26827652, 31064831, 33115695, 36142507, 37264161, 40168071
Alzheimer Disease	Inhibit	40023574
Amyotrophic Lateral Sclerosis	Associate	31999342
Amyotrophic lateral sclerosis 1	Associate	35853630
Anemia	Associate	25881102
Anemia Sickle Cell	Associate	22430884
Anorexia	Associate	34924131
Antisocial Personality Disorder	Associate	25918995
Anxiety	Associate	32015454
Arthralgia	Associate	27747906
Arthritis Rheumatoid	Associate	16504991, 20080907, 27323187, 28132103, 29670920, 30532219, 33017281, 36724603
Ascites	Associate	19603017, 28606429, 30526541
Asthma	Associate	26598078
Astrocytoma	Associate	28137267
Atherosclerosis	Associate	11461099, 11529503
Atrial Fibrillation	Associate	32899083, 37420302
Attention Deficit Disorder with Hyperactivity	Associate	20166790
Autism Spectrum Disorder	Associate	29369497
Autistic Disorder	Associate	28470827
Autoimmune Diseases	Associate	12181055, 12829023, 15569157, 28534442
Autoimmune Diseases	Inhibit	40023574
Bacterial Infections	Associate	18403618
Balkan Nephropathy	Associate	37629712
Bile Duct Neoplasms	Associate	26001650
Bipolar Disorder	Associate	29668471, 36698099
Bipolar Disorder	Inhibit	36698099
Blood Platelet Disorders	Associate	23116553, 27641736
Bone Marrow Diseases	Associate	21955855, 25582575, 9920827
Bone Neoplasms	Associate	24083708
Brain Diseases	Associate	15473912, 20921883, 34008992
Brain Injuries Traumatic	Associate	23896815, 25891836, 26400323
Brain Neoplasms	Associate	28137267
Breast Neoplasms	Associate	10381498, 10638986, 11305953, 11346468, 11355955, 11509559, 11937596, 1355661, 1357834, 15034303, 15047700, 15771955, 15986399, 16168133, 16309213 View all (116 more)
Breast Neoplasms	Stimulate	36867605
Bronchiolitis Obliterans Syndrome	Stimulate	29352737
Bronchiolitis Obliterans Syndrome	Associate	29689130
Burkitt Lymphoma	Associate	32171300
Calcinosis Cutis	Associate	15015610
Cancer Pain	Associate	23803057
Candidiasis	Associate	28507109
Carcinogenesis	Associate	11351043, 17300681, 19331170, 23977225, 27709738
Carcinogenesis	Inhibit	25793771
Carcinoma Ductal	Associate	20056007, 8766529
Carcinoma Hepatocellular	Stimulate	12428063
Carcinoma Hepatocellular	Associate	15112342, 15948236, 16521213, 16733848, 17666793, 19322916, 19447220, 20085590, 22927901, 23037162, 23109454, 23317199, 23532266, 23792120, 23925649 View all (16 more)
Carcinoma Intraductal Noninfiltrating	Associate	20056007, 24093668
Carcinoma Mucoepidermoid	Associate	24013781
Carcinoma Non Small Cell Lung	Associate	12177790, 15277258, 1680367, 17534875, 17593626, 19006072, 20082278, 22296372, 23443122, 24933103, 25769882, 25964055, 26376998, 26632382, 27706681 View all (14 more)
Carcinoma Non Small Cell Lung	Stimulate	18809583
Carcinoma Non Small Cell Lung	Inhibit	32503508
Carcinoma Ovarian Epithelial	Associate	19603017, 20921883, 23917080, 32429133, 33326171, 36799490, 7863796
Carcinoma Pancreatic Ductal	Associate	32243098, 32375296
Carcinoma Papillary	Associate	20673976
Carcinoma Renal Cell	Associate	10190320, 10839301, 1672598, 17177989, 19393132, 19552816, 1967174, 21199801, 23462807, 2481665, 25861751, 31007253, 33838279, 36077583, 8698736
Carcinoma Renal Cell	Stimulate	35163092
Carcinoma Squamous Cell	Associate	12073053, 17120199, 28099906, 30865384, 31952518, 8543635
Carcinoma Transitional Cell	Associate	1680203, 7848886
Cardiomyopathy Right Ventricular Dilated	Associate	29791609
Cardiotoxicity	Associate	26799497, 36316809
Cardiovascular Diseases	Associate	20801494, 29397568, 29936693, 39459499
Cerebral Amyloid Angiopathy	Associate	15975076
Chemical and Drug Induced Liver Injury	Associate	30419834, 31240859
Chemotherapy Related Cognitive Impairment	Associate	32756886, 37940345
Child Development Disorders Pervasive	Associate	20166790
Cholangiocarcinoma	Associate	28422725, 32334452
Cholangitis	Associate	14526408
Chondrosarcoma	Associate	19445670, 37148005
Chordoma	Associate	21143841
Chromosome Aberrations	Associate	7536492
Chronic Disease	Associate	19762492
Chronic Pain	Associate	23803057, 31738228
Cirrhosis Familial	Associate	33978213
Clear cell metastatic renal cell carcinoma	Associate	26001650
Cleft Lip	Associate	34032749
Cleft Palate	Associate	12176916
Cocaine Related Disorders	Associate	25918995
Cognition Disorders	Associate	33731765, 40168071
Cognitive Dysfunction	Associate	40168071
Colitis Ulcerative	Associate	14610718, 16462040, 17206635, 21830274, 22661185, 23537364, 24838898, 25526204, 25755800, 29543864, 36450761, 37090740
Colonic Diseases	Associate	36411191
Colonic Neoplasms	Associate	16107775, 16819187, 17541169, 17579122, 18414651, 20217131, 21382175, 2481665, 24901645, 31527404, 33974673, 37187089, 7738186, 8098614, 8912533
Colorectal Neoplasms	Associate	11676863, 1355483, 15222051, 16702732, 16800822, 18267032, 18673531, 19192650, 19250544, 19298255, 20177420, 20533057, 22394004, 22396794, 22460269 View all (52 more)
Colorectal Neoplasms	Inhibit	25793771
Colorectal Neoplasms	Stimulate	28146436
Communicable Diseases	Associate	9920827
Congenital Abnormalities	Associate	28288183
Coronary Artery Disease	Associate	32702814
Coronary Disease	Associate	33232268, 34563206
Corticosteroid Binding Globulin Deficiency	Associate	24838898
COVID 19	Associate	34142560
Coxa Magna	Associate	28422712, 33252269
Craniocerebral Trauma	Associate	26823873
Crohn Disease	Associate	14610718, 22661185, 23537364, 24395888, 24838898, 28759738
Cutaneous Fistula	Stimulate	25918995
Cystic Fibrosis	Associate	12070134, 1375156, 15964250
Cytomegalovirus Infections	Associate	19470683
Death	Associate	20533057, 30256048, 36316809, 40282412, 8093700
Degloving Injuries	Associate	26988277
Delayed Graft Function	Associate	19470683
Delusional Parasitosis	Associate	24918524
Dementia Multi Infarct	Associate	25792670, 25854371, 9886170
Demyelinating Diseases	Associate	35256320
Depressive Disorder	Associate	17142980, 21955855, 21999196, 23356581, 32015454
Depressive Disorder Major	Associate	36698099
Depressive Disorder Major	Inhibit	36698099
Diabetes Gestational	Stimulate	22558111
Diabetes Mellitus	Stimulate	25815791
Diabetes Mellitus	Associate	29621269, 33053111
Diabetes Mellitus Type 2	Associate	32762489, 33072207, 36734157
Diarrhea	Associate	17534875, 19349543, 23828747, 25410489, 25691056, 32354939, 40282412
Disease	Associate	18765553
Disease Resistance	Associate	10070873, 11747345, 11948195, 15517878, 16507781, 19143835, 20856196, 21703341, 22353810, 22701315, 23037162, 23564041, 23673445, 24380367, 24676670 View all (8 more)
Disease Resistance	Stimulate	28656316, 28864784, 30353128, 34502219, 9642215
Disorders of Excessive Somnolence	Associate	34463270
Dizziness	Associate	34463270, 37894954
Drug Hypersensitivity	Associate	15004162
Drug Related Side Effects and Adverse Reactions	Associate	10498614, 11379779, 11747345, 12081145, 15473912, 16651436, 16930294, 18403618, 18687982, 18687998, 19470292, 20127092, 20177420, 20179710, 20663232 View all (39 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	15569157
Drug Related Side Effects and Adverse Reactions	Inhibit	17573715, 20957165, 7925305
Drug Resistant Epilepsy	Stimulate	10029595, 2765667, 9722297
Drug Resistant Epilepsy	Associate	10704438, 10779437, 12686700, 1355660, 15857428, 16542858, 1657846, 16627975, 16650134, 17593626, 18494787, 19603017, 20082268, 20532504, 20922799 View all (19 more)
Duane Retraction Syndrome	Associate	28146436
Dyskinesias	Associate	21781437
Dyslipidemias	Associate	23073467, 34563206
Dyspnea	Associate	38287944
Endometrial Neoplasms	Associate	14675353, 1707232, 17300681, 36965280
Enteritis	Inhibit	18403618
Enterocolitis Neutropenic	Associate	27545217
Ependymoma	Associate	20406235, 31311995
Epidermal Cyst	Associate	15750166, 17617464, 25036383
Epilepsies Partial	Associate	25223475
Epilepsy	Associate	11879359, 12558585, 12686700, 15473912, 16386926, 16542858, 18329296, 19453704, 20064729, 21079659, 21316268, 21388909, 21530324, 21636342, 22033938 View all (9 more)
Epilepsy	Stimulate	22606322
Epilepsy Familial Mesial Temporal Lobe	Associate	24586633, 30030837
Epilepsy Idiopathic Generalized	Associate	18329296, 21079659
Epilepsy Temporal Lobe	Associate	35430998
Epileptic Syndromes	Associate	19453704, 22033938
Epstein Barr Virus Infections	Stimulate	16378986
Epstein Barr Virus Infections	Associate	26153782
Esophageal Neoplasms	Associate	16702732, 23721345, 27941276
Esophageal Squamous Cell Carcinoma	Associate	16702732, 26768616, 26823755, 27941276, 30865384, 32611208, 33709789
Essential Hypertension	Associate	19197249, 24522199
Exanthema	Associate	22515119
Febrile Neutropenia	Associate	28036387
Femur Head Necrosis	Associate	24387690
Fetal Membranes Premature Rupture	Associate	21430233
Fever	Stimulate	11369762, 18283591, 25988710
Fever	Inhibit	38350654
Fibrocystic Breast Disease	Associate	25062490
Fibrosis	Associate	24838898
Focal Cortical Dysplasia	Associate	17482840
Gallbladder Neoplasms	Associate	14669341, 28492560, 32058310
Gastrointestinal Diseases	Associate	33035787
Gastrointestinal Neoplasms	Associate	25333257
Gastrointestinal Stromal Tumors	Associate	17922049, 28335376
GATA2 Deficiency	Associate	11079620, 9885221
Genetic Diseases Inborn	Associate	31778598
Glioblastoma	Associate	10639573, 11351043, 18687982, 24380367, 25226230, 26447477, 28019039, 28137267, 36477472, 8883415
Glioma	Associate	14655754, 27662839, 28019039, 28534371, 31409725, 7640227, 8688320, 8780389
Gliosis	Associate	15101825
Glomerulosclerosis Focal Segmental	Associate	25559283
Graft vs Host Disease	Associate	26325438, 28807771
Granulomatous Disease Chronic	Associate	8547675
Hallucinations	Associate	18257092
Head and Neck Neoplasms	Associate	12460464, 26823873
Heart Defects Congenital	Associate	23874772
Heart Diseases	Associate	30212560
Heart Failure	Associate	17652833, 23356581, 25164709
Heart Septal Defects	Associate	23874772
Helicobacter Infections	Associate	22001987
Hematologic Diseases	Associate	32871888, 33326171, 37058477
Hematologic Neoplasms	Associate	21918980, 26790444, 30641875, 7565762, 9541688, 9669392, 9879641, 9885221
Hemorrhage	Associate	29936693, 30742211, 33179295, 36368930, 37420302, 37641689, 39459499
Hepatitis B	Associate	32871888
Hepatitis B Chronic	Associate	27999186
Hepatitis C	Associate	23109454
Hepatitis C Chronic	Associate	22166890
Hepatitis E	Associate	10817511
Hepatitis Viral Human	Associate	27706454, 37512019
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30894541, 33167906
HIV Infections	Inhibit	11079620
HIV Infections	Associate	12593536, 15659247, 19819348, 20696882, 21041912, 21743379, 22297601, 23372834, 25557407, 27334660
Hodgkin Disease	Associate	21762523, 25840583
Hypercholesterolemia	Associate	40532247
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	22363694
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	25982326
Hyperkinesis	Associate	20166790
Hyperlipoproteinemia Type II	Associate	16138223
Hyperparathyroidism	Associate	28806349
Hyperprolactinemia	Associate	32198935
Hypertension	Associate	23161145, 27338075, 27649668, 28792917
Hypocalcemia	Associate	40282412
Hypotension	Associate	27338075
Hypotension Orthostatic	Associate	21999196
Hypoxia	Stimulate	14647149, 18385176, 24901645, 26846577, 28509582, 29305422, 34181359, 36265170
Hypoxia	Associate	27604859, 29898734, 36748372
Hypoxia Brain	Associate	20217131, 21595915
Hypoxia Brain	Stimulate	23827654
Immunoglobulin G4 Related Disease	Associate	23564041
Immunologic Deficiency Syndromes	Associate	8676093
Infections	Inhibit	18403618, 37058477
Infections	Associate	22001987, 25921280, 32871888, 36721242
Infections	Stimulate	26153782
Infertility	Associate	19815951, 26125837
Infertility Male	Associate	19815951, 26125837
Inflammation	Associate	19629677, 23731729, 24395888, 32613204, 33017281, 35973536, 36142507, 36482035, 37834286, 40023574
Inflammation	Stimulate	21430233, 36983062
Inflammatory Bowel Diseases	Associate	14610718, 15486347, 19115152, 22661185, 23537364, 23828747, 24838898, 25755800, 29543864
Influenza Human	Associate	27821506
Intestinal Neoplasms	Associate	1680366
Ischemic Attack Transient	Associate	30742211
Kidney Diseases	Associate	33785019
Kidney Neoplasms	Associate	1684451, 2481665, 32876994, 34915026
Kidney Tubular Necrosis Acute	Associate	11422747
Klatskin Tumor	Associate	15655831
Lacrimal Duct Obstruction	Associate	32406606
Language Disorders	Associate	40168071
Laryngeal Neoplasms	Associate	29483928, 36033826
Lateral meningocele syndrome	Associate	17922049
Leiomyosarcoma	Associate	17922049, 36344048
Leukemia	Associate	11170105, 12139246, 12486126, 12525496, 15351976, 16051742, 16769721, 17852455, 18200595, 18249061, 18271955, 18723777, 19414348, 19635183, 20209646 View all (19 more)
Leukemia Biphenotypic Acute	Associate	9450804
Leukemia Erythroblastic Acute	Associate	11379779
Leukemia Large Granular Lymphocytic	Associate	37078709, 7680244, 9885221
Leukemia Lymphocytic Chronic B Cell	Associate	17085864, 25586345, 26354214, 27536777, 29945498, 36077209, 9074409, 9722297
Leukemia Lymphoma Adult T Cell	Associate	11167822, 1978691, 25448402
Leukemia Lymphoma Adult T Cell	Stimulate	9516147
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11552983, 12176916, 12609962, 15963852, 18524988, 19394750, 21356308, 21520403, 22823957, 22975581, 23272163, 23683876, 23891189, 25087925, 25089713 View all (10 more)
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	26250462
Leukemia Myeloid	Associate	21677772, 24621983, 2891711, 3481435, 7949184, 8676093, 9516145
Leukemia Myeloid Acute	Associate	10233413, 10361105, 10419902, 10651723, 10779437, 11122104, 11154229, 11313277, 11369657, 11493443, 12525496, 1370388, 15661399, 15994288, 16138358 View all (53 more)
Leukemia Myeloid Acute	Stimulate	1355660
Leukemia Prolymphocytic T Cell	Stimulate	1355660, 9722297
Leukemia Promyelocytic Acute	Associate	10651729, 10792272, 16258264, 7622426, 8555497, 9516145
Leukemia T Cell	Associate	1355660, 17909680, 19344413, 2572270, 7512893, 9516147, 9744497
Leukoencephalopathies	Associate	33037101
Leukopenia	Associate	33709789
Lichen Planus Oral	Associate	29267659
Liver Cirrhosis	Associate	27543206
Liver Diseases	Associate	37641689
Liver Failure	Associate	14526408, 23401306, 25921280
Liver Neoplasms	Associate	15936020, 24676670
Lown Ganong Levine Syndrome	Associate	38163893
Lung Neoplasms	Associate	10375741, 10565770, 11585860, 14610319, 17120199, 19107762, 19484794, 22179563, 23443122, 25122423, 25563194, 25988710, 26098947, 26219569, 27995666 View all (11 more)
Lupus Erythematosus Systemic	Associate	15934077, 18451510, 18820766, 35757721, 37950194
Lupus Nephritis	Associate	22380717, 24548980, 31685786
Lupus Vasculitis Central Nervous System	Associate	28626187
Lymphadenitis	Associate	7961124
Lymphatic Metastasis	Associate	11305953, 20217131, 24884960, 28362720, 36799490, 8749949
Lymphatic Metastasis	Stimulate	25964055
Lymphoma	Associate	16309213, 17634410, 19414348, 21918980, 2572270, 27564097, 7632959, 9160686, 9473242
Lymphoma B Cell	Associate	21300134, 7589484
Lymphoma Extranodal NK T Cell	Associate	18093334, 18756548
Lymphoma Large B Cell Diffuse	Associate	17179223, 25909227, 26286835, 32871888
Lymphoma Mantle Cell	Associate	29695404, 37058477
Lymphoma Non Hodgkin	Associate	24756092, 25769453, 27566557
Lymphoma T Cell	Associate	27564097
Lymphoma T Cell Cutaneous	Associate	36553668
Lymphoma T Cell Peripheral	Associate	22833464
Lymphoproliferative Disorders	Associate	26153782
malar rash	Associate	18820766
Malformations of Cortical Development	Associate	12558585
Medulloblastoma	Associate	24887326
Melanoma	Associate	11286621, 15009716, 15999103, 17943188, 18604175, 25300205, 28293855, 7495278, 8976731
Meningioma	Associate	14723263
Mental Disorders	Associate	29668471
Mesothelioma Malignant	Associate	11697834, 18385176, 26004871, 29261027, 30423827, 30689265, 7925305
Mohr Tranebjaerg syndrome	Associate	31539112
Mohr Tranebjaerg syndrome	Stimulate	33125122
Mood Disorders	Associate	17142980, 29668471
Mouth Neoplasms	Associate	12073053, 34092610
Movement Disorders	Associate	35727214
Mucositis	Associate	28727815
Multiple Myeloma	Associate	1348425, 1676918, 16929535, 17488488, 20532504, 22434582, 23475625, 23589314, 24400589, 2568864, 26790444, 27039718, 28509582, 29177954, 30079960 View all (6 more)
Multiple Sclerosis	Associate	33037101
Multiple Sclerosis Relapsing Remitting	Stimulate	32386505
Multiple Trauma	Associate	7692586
Muscular Diseases	Associate	36277691
Myasthenia Gravis	Associate	18717915
Myelodysplastic Syndromes	Associate	15020609, 23684483, 9734653
Myocardial Infarction	Associate	20801494, 35473443
Myoclonic Epilepsy Juvenile	Associate	24586633
Nasopharyngeal Carcinoma	Associate	24340057
Nausea	Associate	25340731, 27883323, 29546524, 33794950, 40282412
Necrosis	Associate	11794258, 1679995
Neoplasm Invasiveness	Associate	20056007, 24093668
Neoplasm Metastasis	Associate	15015610, 15112275, 20234362, 22180460, 28362720, 33566445, 37544307, 39180062, 8098614
Neoplasm Metastasis	Stimulate	20921883, 26790551
Neoplasm Residual	Stimulate	24145140
Neoplasms	Associate	10395948, 10411657, 10420992, 10606895, 10638986, 10747957, 10890910, 11286621, 11294418, 11518543, 11823484, 11850258, 11948195, 12015757, 12073053 View all (303 more)
Neoplasms	Inhibit	16083877, 19192650, 23542236, 28827665
Neoplasms	Stimulate	22245726, 29305422, 33340130
Neoplasms Cystic Mucinous and Serous	Associate	32429133
Neoplasms Germ Cell and Embryonal	Associate	12644825
Nephrosis congenital	Associate	25559283
Nephrotic Syndrome	Associate	15934077, 29615122, 33785019, 34603785
Nervous System Diseases	Associate	16950614, 18628469
Neural Tube Defects	Associate	23684483
Neuralgia	Associate	31738228
Neuroblastoma	Associate	10376971, 12885402, 16547352, 1678252, 1679995, 1682809, 22088485, 25111243, 2573830, 27517323, 34465595, 9818076
Neurodegenerative Diseases	Associate	22837672, 25218792, 35256320
Neurotoxicity Syndromes	Associate	18628469, 25084203, 31571407, 33326171
Neutropenia	Associate	16950614, 17534875, 18628469, 19470925, 25340731, 25410489, 26244574, 27845419, 28036387, 28817838, 32778670, 33955129, 39596349
Non alcoholic Fatty Liver Disease	Associate	21878559
Obesity	Associate	18442890
Obesity	Stimulate	26084465
Obstetric Labor Premature	Stimulate	21430233
Orofacial Cleft 4	Associate	23443032
Osteosarcoma	Associate	11294418, 11794258, 12695554, 15112275, 16602111, 22016816, 24083708, 24841650, 24996541, 26300407, 26408180, 26603906, 26790551, 27287205, 30430199 View all (6 more)
Ototoxicity	Associate	19571437, 22630058, 24595806, 27886333, 30505321, 37768946, 7692586
Ovarian Neoplasms	Associate	16401397, 17459055, 17611393, 17828752, 18765553, 19040611, 19401306, 19516889, 20540746, 21618519, 21955855, 22792399, 23098446, 23174937, 23542236 View all (32 more)
Pain	Associate	23803057, 27883323, 31738228, 35727214
Pain Postoperative	Associate	27883323, 40331998
Pancreatic Neoplasms	Associate	17695494, 20922799, 25036383, 28099906, 29550476, 32924881, 33053111, 37108495, 37857015, 38163893, 8605092, 8766529
Paresthesia	Associate	34463270
Parkinson Disease	Associate	22971641, 26457621
Pemphigoid Bullous	Associate	29948283
Peptic Ulcer	Associate	22001987
Peripheral Nervous System Diseases	Associate	16950614, 18628469
Pituitary Neoplasms	Associate	16953066
Pleural Neoplasms	Associate	2479079
Pleurisy	Associate	18820766
Postoperative Nausea and Vomiting	Associate	29546524
Precancerous Conditions	Associate	23977225, 25355168
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	11849207, 12130511, 16382213, 19065772, 20423567, 21538216, 23244145, 25582575, 25697355, 25854371, 25921280, 2765667, 27960630, 30256048, 36952646 View all (6 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10050716, 10354131, 10792272, 11167822, 12648071, 12780787, 1380280, 15142118, 15384974, 15667534, 17488488, 17573715, 17854304, 20423567, 21679421 View all (9 more)
Pressure Ulcer	Associate	26830973
Prostatic Intraepithelial Neoplasia	Associate	24344919
Prostatic Neoplasms	Inhibit	17440963
Prostatic Neoplasms	Associate	18076941, 18628469, 20053773, 20649571, 21694441, 23861346, 24344919, 26459268, 34326198, 36602227, 36614114, 37796964
Prostatitis	Associate	11279018, 11909640, 16083877, 16323173, 24344919
Protoporphyria Erythropoietic	Associate	36952646
Pulmonary Disease Chronic Obstructive	Associate	21243282, 23731729, 29791609, 33072207
Purpura Thrombocytopenic Idiopathic	Associate	12181055, 12829023, 27258931
Renal Insufficiency Chronic	Associate	11422747
Retinal Dysplasia	Associate	23977225
Retinoblastoma	Associate	15548804, 25173639
Rhabdomyosarcoma	Stimulate	10470293
Rhabdomyosarcoma	Associate	15015604
Rhabdomyosarcoma Alveolar	Associate	18377424
Rhabdomyosarcoma Embryonal	Associate	10470293, 18377424
Sarcoma	Associate	15563462, 17692467, 27683125, 29689707, 7903154, 8664189, 9038218, 9298839
Sarcoma Ewing	Associate	37731501, 7903154, 8093700
Sarcoma Kaposi	Associate	21829205
Sarcoma Synovial	Associate	17464317
Schizophrenia	Associate	17142980, 18718676, 24918524, 29668471
Scleroderma Systemic	Associate	28534442
Seizures	Associate	18329296, 19453704, 22606322, 23717663, 32054883
SeSAME syndrome	Associate	26535588
Sexual Dysfunction Physiological	Associate	23356581, 33785019
Shoulder Pain	Associate	35727214
Sick Sinus Syndrome	Associate	7961124
Sigmoid Neoplasms	Associate	25355168
Sjogren's Syndrome	Associate	34386009
Small Cell Lung Carcinoma	Associate	11822755, 14610319, 17327908, 17667922, 2571355, 27367030, 32114419, 8104371, 8213218, 9652763
Soft Tissue Neoplasms	Associate	9669390
Solitary Fibrous Tumors	Associate	35864381
Spasms Infantile	Associate	22033938
Spondylitis Ankylosing	Associate	28151874
Squamous Cell Carcinoma of Head and Neck	Associate	12073053, 15113040, 22180460, 22276165, 25275603, 29171106, 33134377
Squamous Intraepithelial Lesions of the Cervix	Associate	23464400
Status Asthmaticus	Associate	26598078
Stevens Johnson Syndrome	Associate	25876064
Stomach Neoplasms	Associate	10446694, 12071854, 12085207, 14726695, 15040019, 15771954, 15875780, 16340247, 16410721, 17952118, 18673531, 19091131, 19143835, 19331170, 19638344 View all (29 more)
Stomach Neoplasms	Stimulate	26084465
Stomatitis	Associate	23244145
Stroke	Associate	18622260, 20801494, 30742211
Substance Related Disorders	Associate	19040611
Tertiary Lymphoid Structures	Associate	16168133, 23280016, 7961124
Testicular Germ Cell Tumor	Associate	39258697
Tetralogy of Fallot	Associate	30212560
Thrombocytopenia	Associate	25340731, 25881102, 33326171
Thrombosis	Associate	32899083
Thymoma	Associate	32932043
Thyroid Carcinoma Anaplastic	Associate	34360846
Thyroid Neoplasms	Associate	15750166, 23803106
Tooth Loss	Associate	29689130
Transient erythroblastopenia of childhood	Associate	39216306
Tremor	Associate	15886424
Triple Negative Breast Neoplasms	Associate	26767845, 27527855, 27813130, 31742868, 32471192, 36291159
Tuberculosis Meningeal	Associate	37834286
Tuberculosis Multidrug Resistant	Associate	10190320, 10354131, 10381498, 10395948, 10468850, 10470293, 10498614, 10733510, 10747957, 10890910, 10930993, 10949126, 11170105, 11278745, 11279018 View all (232 more)
Tuberculosis Multidrug Resistant	Stimulate	10963297, 12799644, 19538007, 1972154, 20957165, 22191778, 22228759, 22927901, 23542036, 23593363, 27824156, 28597653, 33079995, 3368466, 3472246 View all (5 more)
Tuberculosis Multidrug Resistant	Inhibit	20856196
Urethral Neoplasms	Associate	35610207, 8749949
Urinary Bladder Neoplasms	Associate	12884023, 1684451, 20689757, 23495258, 28560953, 32131547, 33720323, 34048174, 34270461, 35610207, 7734314, 7908215, 8567404
Urinary Bladder Neurogenic	Stimulate	1680203
Uterine Cervical Neoplasms	Associate	22245869, 28659181, 29151072, 31180057, 31424649
Uterine Neoplasms	Associate	22927901
Ventricular Dysfunction Right	Associate	29791609
Verloove Vanhorick Brubakk syndrome	Associate	23443032
Vomiting	Associate	23358260, 40282412
Weight Gain	Associate	18718676, 27897267
Weight Loss	Associate	36982571, 37993699
Wilms Tumor	Associate	7965510

ABCB1 (ATP binding cassette subfamily B member 1)