Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5203
Gene name	Prefoldin subunit 4
Gene symbol	PFDN4
Synonyms (NCBI Gene)	C1PFD4
Chromosome	20
Chromosome location	20q13.2
Summary	This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The

Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020799	hsa-miR-155-5p	Proteomics	18668040
MIRT734552	hsa-miR-26a-5p	Luciferase reporter assayMicroarray	32494663
MIRT1226120	hsa-miR-1297	CLIP-seq
MIRT1226121	hsa-miR-1324	CLIP-seq
MIRT1226122	hsa-miR-200b	CLIP-seq
MIRT1226123	hsa-miR-200c	CLIP-seq
MIRT1226124	hsa-miR-26a	CLIP-seq
MIRT1226125	hsa-miR-26b	CLIP-seq
MIRT1226126	hsa-miR-3163	CLIP-seq
MIRT1226127	hsa-miR-330-3p	CLIP-seq
MIRT1226128	hsa-miR-338-5p	CLIP-seq
MIRT1226129	hsa-miR-376c	CLIP-seq
MIRT1226130	hsa-miR-425	CLIP-seq
MIRT1226131	hsa-miR-4272	CLIP-seq
MIRT1226132	hsa-miR-429	CLIP-seq
MIRT1226133	hsa-miR-4465	CLIP-seq
MIRT1226134	hsa-miR-4477a	CLIP-seq
MIRT1226135	hsa-miR-4668-3p	CLIP-seq
MIRT1226136	hsa-miR-4778-3p	CLIP-seq
MIRT1226137	hsa-miR-491-3p	CLIP-seq
MIRT1226138	hsa-miR-513a-3p	CLIP-seq
MIRT1226139	hsa-miR-520d-5p	CLIP-seq
MIRT1226140	hsa-miR-524-5p	CLIP-seq
MIRT1226141	hsa-miR-642b	CLIP-seq
MIRT1226130	hsa-miR-425	CLIP-seq
MIRT2066098	hsa-miR-4786-3p	CLIP-seq
MIRT2293754	hsa-miR-3166	CLIP-seq
MIRT2293755	hsa-miR-3607-5p	CLIP-seq
MIRT2293756	hsa-miR-3647-3p	CLIP-seq
MIRT2293757	hsa-miR-587	CLIP-seq
MIRT2293758	hsa-miR-885-5p	CLIP-seq
MIRT1226122	hsa-miR-200b	CLIP-seq
MIRT1226123	hsa-miR-200c	CLIP-seq
MIRT2591818	hsa-miR-3065-5p	CLIP-seq
MIRT1226126	hsa-miR-3163	CLIP-seq
MIRT2293754	hsa-miR-3166	CLIP-seq
MIRT2293755	hsa-miR-3607-5p	CLIP-seq
MIRT2591819	hsa-miR-3646	CLIP-seq
MIRT2293756	hsa-miR-3647-3p	CLIP-seq
MIRT1226129	hsa-miR-376c	CLIP-seq
MIRT1226132	hsa-miR-429	CLIP-seq
MIRT2591820	hsa-miR-4501	CLIP-seq
MIRT1226136	hsa-miR-4778-3p	CLIP-seq
MIRT2066098	hsa-miR-4786-3p	CLIP-seq
MIRT1226137	hsa-miR-491-3p	CLIP-seq
MIRT1226138	hsa-miR-513a-3p	CLIP-seq
MIRT2591821	hsa-miR-548c-3p	CLIP-seq
MIRT2293757	hsa-miR-587	CLIP-seq
MIRT1226141	hsa-miR-642b	CLIP-seq
MIRT2293758	hsa-miR-885-5p	CLIP-seq
MIRT1226122	hsa-miR-200b	CLIP-seq
MIRT1226123	hsa-miR-200c	CLIP-seq
MIRT1226126	hsa-miR-3163	CLIP-seq
MIRT2293754	hsa-miR-3166	CLIP-seq
MIRT2293755	hsa-miR-3607-5p	CLIP-seq
MIRT2293756	hsa-miR-3647-3p	CLIP-seq
MIRT1226129	hsa-miR-376c	CLIP-seq
MIRT1226132	hsa-miR-429	CLIP-seq
MIRT2591820	hsa-miR-4501	CLIP-seq
MIRT1226136	hsa-miR-4778-3p	CLIP-seq
MIRT2066098	hsa-miR-4786-3p	CLIP-seq
MIRT1226137	hsa-miR-491-3p	CLIP-seq
MIRT1226138	hsa-miR-513a-3p	CLIP-seq
MIRT2591821	hsa-miR-548c-3p	CLIP-seq
MIRT1226141	hsa-miR-642b	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	23614719
GO:0005515	Function	Protein binding	IPI	17936702, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	17936702
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17936702
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17936702
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	NAS	9630229
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	NAS	32699605
GO:0006457	Process	Protein folding	TAS	9630229
GO:0016272	Component	Prefoldin complex	IBA
GO:0016272	Component	Prefoldin complex	IDA	23614719, 30955883
GO:0016272	Component	Prefoldin complex	IEA
GO:0016272	Component	Prefoldin complex	NAS	32699605
GO:0032991	Component	Protein-containing complex	IEA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IDA	30955883
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	TAS	9630229
GO:1905907	Process	Negative regulation of amyloid fibril formation	IDA	23614719

MIM	HGNC	e!Ensembl
604898	8868	ENSG00000101132

Q9NQP4

Protein name

Prefoldin subunit 4 (Protein C-1)

Protein function

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. {ECO:0000269|Pub

PDB

6NR8 , 6NR9 , 6NRB , 6NRC , 6NRD , 7WU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01920	Prefoldin_2	20 → 126	Prefoldin subunit	Coiled-coil

Sequence

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGSNINLEADES

Sequence length

134

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC HUMAN PAPILLOMAVIRUS INFECTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Ovarian Epithelial	Associate	33173439	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	31957800	★★★★★ ★☆☆☆☆ Found in Text Mining only

PFDN4 (prefoldin subunit 4)