PF4 (platelet factor 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5196
Gene name Platelet factor 4
Gene symbol PF4
Synonyms (NCBI Gene)
CXCL4PF-4SCYB4
Chromosome 4
Chromosome location 4q13.3
Summary This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is ch
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT022104 hsa-miR-125b-5p Other 20194440
Transcription factors Transcription factors information provided by TRRUST V2 database.
14
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (14)
Transcription factor Regulation Reference
ETS1 Activation 12609849
ETS1 Unknown 23848403
FLI1 Unknown 23848403
GATA1 Activation 12609849
MEIS1 Activation 12609849;12732210
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (50)
GO ID Ontology Definition Evidence Reference
GO:0002548 Process Monocyte chemotaxis IDA 29930254
GO:0002548 Process Monocyte chemotaxis IDA 29930254
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 19805618, 28381538, 34445266
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
173460 8861 ENSG00000163737
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P02776
Protein name Platelet factor 4 (PF-4) (C-X-C motif chemokine 4) (Iroplact) (Oncostatin-A) [Cleaved into: Platelet factor 4, short form (Endothelial cell growth inhibitor)]
Protein function Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed:29930254, PubMed:9531587). Acts via different functional rece
PDB 1DN3 , 1F9Q , 1F9R , 1F9S , 1PFM , 1PFN , 1RHP , 4R9W , 4R9Y , 4RAU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 39 → 98 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence 
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		  Platelet degranulation
Common Pathway of Fibrin Clot Formation
Cell surface interactions at the vascular wall
Chemokine receptors bind chemokines
G alpha (i) signalling events
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (6)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLAUCOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (88)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Acute Coronary Syndrome Associate 35109843
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Associate 32384511
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Associate 32812532
★★★★★
★☆☆☆☆
Found in Text Mining only
Androgen Insensitivity Syndrome Associate 34867780
★★★★★
★☆☆☆☆
Found in Text Mining only
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 33420306
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriovenous Fistula Associate 37589266
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 18664547
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Stimulate 25858640
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Associate 30669148
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Associate 15591119, 20335529, 35054772
★★★★★
★☆☆☆☆
Found in Text Mining only