PF4 (platelet factor 4)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5196
Gene name Gene Name - the full gene name approved by the HGNC.
Platelet factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PF4
Synonyms (NCBI Gene) Gene synonyms aliases
CXCL4, PF-4, SCYB4
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is ch
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT022104 hsa-miR-125b-5p Other 20194440
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
Transcription factor Regulation Reference
ETS1 Activation 12609849
ETS1 Unknown 23848403
FLI1 Unknown 23848403
GATA1 Activation 12609849
MEIS1 Activation 12609849;12732210
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(38)
GO ID Ontology Definition Evidence Reference
GO:0002576 Process Platelet degranulation TAS
GO:0005515 Function Protein binding IPI 19805618, 28381538
GO:0005576 Component Extracellular region NAS 14718574
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
173460 8861 ENSG00000163737
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P02776
Protein name Platelet factor 4 (PF-4) (C-X-C motif chemokine 4) (Iroplact) (Oncostatin-A) [Cleaved into: Platelet factor 4, short form (Endothelial cell growth inhibitor)]
Protein function Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed:29930254, PubMed:9531587). Acts via different functional rece
PDB 1DN3 , 1F9Q , 1F9R , 1F9S , 1PFM , 1PFN , 1RHP , 4R9W , 4R9Y , 4RAU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 39 → 98 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence 
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		  Platelet degranulation
Common Pathway of Fibrin Clot Formation
Cell surface interactions at the vascular wall
Chemokine receptors bind chemokines
G alpha (i) signalling events
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs869025224 20162249
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Glaucoma Glaucoma GWAS
Show/Hide Text Mining Associations (88)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 35109843
Adenocarcinoma of Lung Associate 32384511
Alzheimer Disease Associate 32812532
Androgen Insensitivity Syndrome Associate 34867780
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 33420306
Arteriovenous Fistula Associate 37589266
Arthritis Rheumatoid Associate 18664547
Arthritis Rheumatoid Stimulate 25858640
Asthma Associate 30669148
Atherosclerosis Associate 15591119, 20335529, 35054772