Gene Gene information from NCBI Gene database.
Entrez ID 5191
Gene name Peroxisomal biogenesis factor 7
Gene symbol PEX7
Synonyms (NCBI Gene)
PBD9BPTS2RRCDP1RD
Chromosome 6
Chromosome location 6q23.3
Summary This gene encodes the cytosolic receptor for the set of peroxisomal matrix enzymes targeted to the organelle by the peroxisome targeting signal 2 (PTS2). Defects in this gene cause peroxisome biogenesis disorders (PBDs), which are characterized by multipl
SNPs SNP information provided by dbSNP.
58
SNP ID Visualize variation Clinical significance Consequence
rs1805137 T>A Pathogenic-likely-pathogenic, pathogenic Stop gained, coding sequence variant, stop lost, terminator codon variant
rs61753233 A>C Pathogenic Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753236 C>T Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753237 A>C Likely-pathogenic Missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs61753238 C>A,G,T Pathogenic Genic upstream transcript variant, upstream transcript variant, stop gained, coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
58
miRTarBase ID miRNA Experiments Reference
MIRT543256 hsa-miR-548n PAR-CLIP 21572407
MIRT543255 hsa-miR-548a-5p PAR-CLIP 21572407
MIRT543254 hsa-miR-548ab PAR-CLIP 21572407
MIRT543253 hsa-miR-548ad-5p PAR-CLIP 21572407
MIRT543252 hsa-miR-548ae-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration IEA
GO:0001958 Process Endochondral ossification IEA
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IBA
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IDA 9090381, 9090383, 11931631, 22057399, 25538232
GO:0005053 Function Peroxisome matrix targeting signal-2 binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601757 8860 ENSG00000112357
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00628
Protein name Peroxisomal targeting signal 2 receptor (PTS2 receptor) (Peroxin-7)
Protein function Receptor required for the peroxisomal import of proteins containing a C-terminal PTS2-type peroxisomal targeting signal (PubMed:11931631, PubMed:22057399, PubMed:25538232, PubMed:9090381). Specifically binds to cargo proteins containing a PTS2 p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 58 96 WD domain, G-beta repeat Repeat
PF00400 WD40 101 141 WD domain, G-beta repeat Repeat
PF00400 WD40 145 184 WD domain, G-beta repeat Repeat
PF00400 WD40 232 271 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitous (PubMed:9090381). Highest expression in pancreas, skeletal muscle and heart (PubMed:9090381). {ECO:0000269|PubMed:9090381}.
Sequence
MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRL
FRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWD
TAKAAGPLQVYKEHAQEVYSVDWS
QTRGEQLVVSGSWDQTVKLWD
PTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTL
RIWD
VKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLG
HTYAIRRVKFSPFHASVLASCSYDFTVRFWN
FSKPDSLLETVEHHTEFTCGLDFSLQSPT
QVADCSWDETIKIYDPACLTIPA
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Peroxisome   Peroxisomal protein import
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
873
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormality of metabolism/homeostasis Likely pathogenic rs2115131765 RCV001814330
Connective tissue disorder Likely pathogenic; Pathogenic rs763514968 RCV002278634
Intermediate form of PEX7 related rhizomelic chondrodysplasia punctata Likely pathogenic rs2115216571 RCV001420996
Melanoma Likely pathogenic rs780751870 RCV005925481
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs1774099296 RCV004557884
Intellectual disability Uncertain significance rs200234391 RCV001252341
Malignant lymphoma, large B-cell, diffuse Benign rs563675060 RCV005868049
Retinal dystrophy Uncertain significance; Conflicting classifications of pathogenicity rs759745913, rs267608255 RCV004815538
RCV004814859
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Astigmatism Associate 30747064
Ataxia Associate 12522768
Chondrodysplasia Punctata Rhizomelic Associate 12522768, 25439727, 34110102, 34229749, 8670791, 9472033
Infections Associate 34524914
Myopia Degenerative Associate 30747064
Neoplasms Associate 37379307
Peroxisomal Disorders Associate 12522768, 8670791
Polyneuropathies Associate 12522768
Refsum Disease Associate 12522768
Rhizomelic chondrodysplasia punctata type 1 Associate 12522768, 25800479