PENK (proenkephalin)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5179
Gene name Gene Name - the full gene name approved by the HGNC.
Proenkephalin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PENK
Synonyms (NCBI Gene) Gene synonyms aliases
PE, PENK-A
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the syn
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT737151 hsa-miR-506-3p Luciferase reporter assay, Western blotting, qRT-PCR 34062009
MIRT738891 hsa-miR-568 HITS-CLIP 33718276
MIRT738892 hsa-miR-4328 HITS-CLIP 33718276
MIRT738888 hsa-miR-300 CLIP-seq
MIRT738887 hsa-miR-381 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
ATF3 Unknown 7935470
JUN Unknown 7935470
REST Repression 21832040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(48)
GO ID Ontology Definition Evidence Reference
GO:0001515 Function Opioid peptide activity IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001662 Process Behavioral fear response IEA
GO:0001666 Process Response to hypoxia IEA
GO:0001964 Process Startle response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
131330 8831 ENSG00000181195
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01210
Protein name Proenkephalin-A [Cleaved into: Synenkephalin; Met-enkephalin (Opioid growth factor) (OGF); PENK(114-133); PENK(143-183); Met-enkephalin-Arg-Gly-Leu; Leu-enkephalin; PENK(237-258); Met-enkephalin-Arg-Phe]
Protein function [Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. ; [Leu-enke
PDB 1PLW , 1PLX , 2LWC , 5E33 , 5E3A , 8JGF , 8JGG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01160 Opiods_neuropep 25 → 70 Vertebrate endogenous opioids neuropeptide Family
Sequence 
MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLK
IWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPM
EPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEE
EVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEA
LPSDEEGESYSKEVPEMEKRYGGFMRF
Sequence length 267
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling 		  Peptide ligand-binding receptors
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
G alpha (i) signalling events
Post-translational protein phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Familial rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 11796754
Lateral sclerosis AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048 11796754
Narcolepsy Narcolepsy rs104894574, rs387906655 17521418
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17199135
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 24804898, 16547969, 16095981, 17375141 ClinVar
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (44)
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 27401687
Adenocarcinoma Stimulate 34911496
Alzheimer Disease Associate 36635346
Arrhythmogenic Right Ventricular Dysplasia Associate 30664203
Branchio Oto Renal Syndrome Associate 7977379
Breast Neoplasms Associate 24489661, 35132081, 36361532
Carcinogenesis Associate 12000709
Carcinoma Hepatocellular Associate 22457049
Carcinoma Pancreatic Ductal Associate 12000709
Carcinoma Small Cell Associate 34911496