Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51765
Gene name Gene Name - the full gene name approved by the HGNC.	Serine/threonine kinase 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STK26
Synonyms (NCBI Gene) Gene synonyms aliases	MASK, MST4
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq26.2
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerizatio

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT754275	hsa-miR-589-3p	PAR-CLIP	27292025
MIRT754275	hsa-miR-589-3p	PAR-CLIP	27292025
MIRT754262	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT754263	hsa-miR-633	PAR-CLIP	21572407
MIRT754264	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT754265	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT754266	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT754267	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT754268	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT754269	hsa-miR-940	PAR-CLIP	21572407
MIRT754270	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT754271	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT754272	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT754273	hsa-miR-5692b	PAR-CLIP	21572407
MIRT754274	hsa-miR-5692c	PAR-CLIP	21572407
MIRT754275	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT754262	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT754263	hsa-miR-633	PAR-CLIP	21572407
MIRT755222	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT755223	hsa-miR-208a-5p	PAR-CLIP	22100165
MIRT755224	hsa-miR-208b-5p	PAR-CLIP	22100165
MIRT755225	hsa-miR-3928-5p	PAR-CLIP	22100165
MIRT755226	hsa-miR-6806-3p	PAR-CLIP	22100165
MIRT755227	hsa-miR-7843-3p	PAR-CLIP	22100165
MIRT755228	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT755229	hsa-miR-3161	PAR-CLIP	22100165
MIRT755230	hsa-miR-599	PAR-CLIP	22100165
MIRT755231	hsa-miR-3613-3p	PAR-CLIP	22100165

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	11641781
GO:0004672	Function	Protein kinase activity	IDA	11641781
GO:0004672	Function	Protein kinase activity	IMP	22797597
GO:0005515	Function	Protein binding	IPI	15037601, 17360971, 18782753, 20332113, 21423148, 21561863, 23455922, 23541896, 27807006, 31515488, 32296183
GO:0005524	Function	ATP binding	IDA	11641781
GO:0005737	Component	Cytoplasm	IDA	17360971, 22291017, 27807006
GO:0005794	Component	Golgi apparatus	IDA	15037601, 22291017, 27807006
GO:0005798	Component	Golgi-associated vesicle	IDA	22797597
GO:0005829	Component	Cytosol	IDA	22797597
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11641781
GO:0006468	Process	Protein phosphorylation	IMP	22291017
GO:0006915	Process	Apoptotic process	IEA
GO:0009267	Process	Cellular response to starvation	IMP	27807006
GO:0012506	Component	Vesicle membrane	TAS	27807006
GO:0016020	Component	Membrane	IDA	27807006
GO:0016324	Component	Apical plasma membrane	IDA	22797597
GO:0030033	Process	Microvillus assembly	IDA	22797597
GO:0030336	Process	Negative regulation of cell migration	IMP	27807006
GO:0042542	Process	Response to hydrogen peroxide	IDA	22291017
GO:0042802	Function	Identical protein binding	IPI	11741893
GO:0042803	Function	Protein homodimerization activity	IPI	21561863
GO:0042981	Process	Regulation of apoptotic process	IDA	11741893
GO:0046777	Process	Protein autophosphorylation	IMP	22797597, 27807006
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22291017
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071944	Component	Cell periphery	IDA	22291017
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1903205	Process	Regulation of hydrogen peroxide-induced cell death	IMP	22291017

MIM	HGNC	e!Ensembl
300547	18174	ENSG00000134602

Protein

UniProt ID

Q9P289

Protein name

Serine/threonine-protein kinase 26 (EC 2.7.11.1) (MST3 and SOK1-related kinase) (Mammalian STE20-like protein kinase 4) (MST-4) (STE20-like kinase MST4) (Serine/threonine-protein kinase MASK)

Protein function

Serine/threonine-protein kinase that acts as a mediator of cell growth (PubMed:11641781, PubMed:17360971). Modulates apoptosis (PubMed:11641781, PubMed:17360971). In association with STK24 negatively regulates Golgi reorientation in polarized ce

PDB

3GGF , 3W8I , 4FZA , 4FZD , 4FZF , 4GEH , 5XY9 , 5YF4 , 7B36

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 274	Protein kinase domain	Domain

Sequence

MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA
EDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQ
IATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFV
GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLV
GDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHS
DDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPA
FAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

Sequence length

416

Interactions

View interactions

	Reactome
			Apoptotic cleavage of cellular proteins

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	36552828
Carcinogenesis	Associate	25650755
Carcinogenesis	Inhibit	32271880
Graves Disease	Associate	28219358
Huntington Disease	Associate	33049985
Hypoxia	Associate	25650755
Hypoxia Brain	Associate	25650755
Inflammation	Associate	28219358
Kidney Failure Chronic	Associate	31464346
Lymphatic Metastasis	Stimulate	36552828
Melanoma Cutaneous Malignant	Associate	31557882
Neoplasms	Associate	25650755
Pancreatic Neoplasms	Associate	30072378, 31912905
Polycystic Ovary Syndrome	Associate	31539108
Prostatic Hyperplasia	Associate	25550858
Prostatic Neoplasms	Associate	25550858, 32859632
Prostatitis	Associate	25550858
Stomach Neoplasms	Associate	32271880

STK26 (serine/threonine kinase 26)