Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	51765
Gene name	Serine/threonine kinase 26
Gene symbol	STK26
Synonyms (NCBI Gene)	MASKMST4
Chromosome	X
Chromosome location	Xq26.2
Summary	The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerizatio

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT754275	hsa-miR-589-3p	PAR-CLIP	27292025
MIRT754275	hsa-miR-589-3p	PAR-CLIP	27292025
MIRT754262	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT754263	hsa-miR-633	PAR-CLIP	21572407
MIRT754264	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT754265	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT754266	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT754267	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT754268	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT754269	hsa-miR-940	PAR-CLIP	21572407
MIRT754270	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT754271	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT754272	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT754273	hsa-miR-5692b	PAR-CLIP	21572407
MIRT754274	hsa-miR-5692c	PAR-CLIP	21572407
MIRT754275	hsa-miR-589-3p	PAR-CLIP	21572407
MIRT754262	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT754263	hsa-miR-633	PAR-CLIP	21572407
MIRT755222	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT755223	hsa-miR-208a-5p	PAR-CLIP	22100165
MIRT755224	hsa-miR-208b-5p	PAR-CLIP	22100165
MIRT755225	hsa-miR-3928-5p	PAR-CLIP	22100165
MIRT755226	hsa-miR-6806-3p	PAR-CLIP	22100165
MIRT755227	hsa-miR-7843-3p	PAR-CLIP	22100165
MIRT755228	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT755229	hsa-miR-3161	PAR-CLIP	22100165
MIRT755230	hsa-miR-599	PAR-CLIP	22100165
MIRT755231	hsa-miR-3613-3p	PAR-CLIP	22100165

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	11641781
GO:0004672	Function	Protein kinase activity	IDA	11641781
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	22797597
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15037601, 17360971, 18782753, 20332113, 21423148, 21561863, 23434407, 23455922, 23541896, 23665169, 27807006, 31515488, 32296183, 32707033, 33961781, 35156780, 35271311, 36012204
GO:0005524	Function	ATP binding	IDA	11641781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17360971, 22291017, 27807006
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	15037601, 22291017, 27807006
GO:0005794	Component	Golgi apparatus	IEA
GO:0005798	Component	Golgi-associated vesicle	IDA	22797597
GO:0005829	Component	Cytosol	IDA	22797597
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11641781
GO:0006915	Process	Apoptotic process	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	IMP	27807006
GO:0012506	Component	Vesicle membrane	TAS	27807006
GO:0016020	Component	Membrane	IDA	27807006
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	IDA	22797597
GO:0016740	Function	Transferase activity	IEA
GO:0030336	Process	Negative regulation of cell migration	IBA
GO:0030336	Process	Negative regulation of cell migration	IMP	27807006
GO:0034599	Process	Cellular response to oxidative stress	IDA	22291017
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	22291017
GO:0042802	Function	Identical protein binding	IPI	11741893
GO:0042803	Function	Protein homodimerization activity	IPI	21561863
GO:0042981	Process	Regulation of apoptotic process	IDA	11741893
GO:0046777	Process	Protein autophosphorylation	IMP	27807006
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22291017
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071944	Component	Cell periphery	IDA	22291017
GO:0090443	Component	FAR/SIN/STRIPAK complex	IDA	18782753
GO:0090443	Component	FAR/SIN/STRIPAK complex	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903698	Process	Positive regulation of microvillus assembly	IDA	22797597

MIM	HGNC	e!Ensembl
300547	18174	ENSG00000134602

Q9P289

Protein name

Serine/threonine-protein kinase 26 (EC 2.7.11.1) (MST3 and SOK1-related kinase) (Mammalian STE20-like protein kinase 4) (MST-4) (STE20-like kinase MST4) (Serine/threonine-protein kinase MASK)

Protein function

Serine/threonine-protein kinase that acts as a mediator of cell growth (PubMed:11641781, PubMed:17360971). Modulates apoptosis (PubMed:11641781, PubMed:17360971). In association with STK24 negatively regulates Golgi reorientation in polarized ce

PDB

3GGF , 3W8I , 4FZA , 4FZD , 4FZF , 4GEH , 5XY9 , 5YF4 , 7B36

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 274	Protein kinase domain	Domain

Sequence

MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA
EDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQ
IATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFV
GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLV
GDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHS
DDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPA
FAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

Sequence length

416

Interactions

View interactions

	Reactome
			Apoptotic cleavage of cellular proteins

STK26 (serine/threonine kinase 26)