Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5175
Gene name Gene Name - the full gene name approved by the HGNC.	Platelet and endothelial cell adhesion molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PECAM1
Synonyms (NCBI Gene) Gene synonyms aliases	CD31, CD31/EndoCAM, GPIIA', PECA1, PECAM-1, endoCAM
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin super

Show/Hide all(227)

miRTarBase ID	miRNA	Experiments
MIRT1224533	hsa-miR-1227	CLIP-seq
MIRT1224534	hsa-miR-1271	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT1224536	hsa-miR-182	CLIP-seq
MIRT1224537	hsa-miR-1972	CLIP-seq
MIRT1224538	hsa-miR-2278	CLIP-seq
MIRT1224539	hsa-miR-24	CLIP-seq
MIRT1224540	hsa-miR-2467-3p	CLIP-seq
MIRT1224541	hsa-miR-3065-5p	CLIP-seq
MIRT1224542	hsa-miR-31	CLIP-seq
MIRT1224543	hsa-miR-3168	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224545	hsa-miR-3192	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT1224547	hsa-miR-339-5p	CLIP-seq
MIRT1224548	hsa-miR-3622b-5p	CLIP-seq
MIRT1224549	hsa-miR-3688-5p	CLIP-seq
MIRT1224550	hsa-miR-3929	CLIP-seq
MIRT1224551	hsa-miR-3945	CLIP-seq
MIRT1224552	hsa-miR-4252	CLIP-seq
MIRT1224553	hsa-miR-4253	CLIP-seq
MIRT1224554	hsa-miR-4257	CLIP-seq
MIRT1224555	hsa-miR-4284	CLIP-seq
MIRT1224556	hsa-miR-4314	CLIP-seq
MIRT1224557	hsa-miR-4419b	CLIP-seq
MIRT1224558	hsa-miR-4421	CLIP-seq
MIRT1224559	hsa-miR-4433	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT1224561	hsa-miR-4468	CLIP-seq
MIRT1224562	hsa-miR-4475	CLIP-seq
MIRT1224563	hsa-miR-4477a	CLIP-seq
MIRT1224564	hsa-miR-4478	CLIP-seq
MIRT1224565	hsa-miR-4499	CLIP-seq
MIRT1224566	hsa-miR-4505	CLIP-seq
MIRT1224567	hsa-miR-4521	CLIP-seq
MIRT1224568	hsa-miR-4642	CLIP-seq
MIRT1224569	hsa-miR-4646-5p	CLIP-seq
MIRT1224570	hsa-miR-4650-5p	CLIP-seq
MIRT1224571	hsa-miR-4693-3p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT1224573	hsa-miR-4722-5p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT1224576	hsa-miR-508-5p	CLIP-seq
MIRT1224577	hsa-miR-548u	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224579	hsa-miR-645	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT1224584	hsa-miR-767-5p	CLIP-seq
MIRT1224585	hsa-miR-96	CLIP-seq
MIRT2065497	hsa-miR-122	CLIP-seq
MIRT2065498	hsa-miR-1225-3p	CLIP-seq
MIRT2065499	hsa-miR-1229	CLIP-seq
MIRT2065500	hsa-miR-1233	CLIP-seq
MIRT2065501	hsa-miR-1246	CLIP-seq
MIRT2065502	hsa-miR-1273f	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT1224540	hsa-miR-2467-3p	CLIP-seq
MIRT2065503	hsa-miR-3134	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2065505	hsa-miR-3155	CLIP-seq
MIRT2065506	hsa-miR-3155b	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT2065507	hsa-miR-3607-5p	CLIP-seq
MIRT2065508	hsa-miR-3614-5p	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065510	hsa-miR-3664-5p	CLIP-seq
MIRT1224554	hsa-miR-4257	CLIP-seq
MIRT2065511	hsa-miR-4320	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2065513	hsa-miR-451b	CLIP-seq
MIRT2065514	hsa-miR-455-3p	CLIP-seq
MIRT2065515	hsa-miR-4634	CLIP-seq
MIRT2065516	hsa-miR-4639-3p	CLIP-seq
MIRT2065517	hsa-miR-4724-5p	CLIP-seq
MIRT2065518	hsa-miR-4766-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT2065520	hsa-miR-484	CLIP-seq
MIRT2065521	hsa-miR-5095	CLIP-seq
MIRT2065522	hsa-miR-510	CLIP-seq
MIRT2065523	hsa-miR-578	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT2065524	hsa-miR-668	CLIP-seq
MIRT2065497	hsa-miR-122	CLIP-seq
MIRT2065499	hsa-miR-1229	CLIP-seq
MIRT2065501	hsa-miR-1246	CLIP-seq
MIRT1224535	hsa-miR-1285	CLIP-seq
MIRT2293266	hsa-miR-146b-3p	CLIP-seq
MIRT1224539	hsa-miR-24	CLIP-seq
MIRT2293267	hsa-miR-302a	CLIP-seq
MIRT2293268	hsa-miR-302b	CLIP-seq
MIRT2293269	hsa-miR-302c	CLIP-seq
MIRT2293270	hsa-miR-302d	CLIP-seq
MIRT2293271	hsa-miR-302e	CLIP-seq
MIRT1224542	hsa-miR-31	CLIP-seq
MIRT2293272	hsa-miR-3126-3p	CLIP-seq
MIRT2065503	hsa-miR-3134	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2293273	hsa-miR-3140-5p	CLIP-seq
MIRT2065505	hsa-miR-3155	CLIP-seq
MIRT2065506	hsa-miR-3155b	CLIP-seq
MIRT2293274	hsa-miR-3173-5p	CLIP-seq
MIRT2293275	hsa-miR-3180	CLIP-seq
MIRT2293276	hsa-miR-3180-3p	CLIP-seq
MIRT1224544	hsa-miR-3187-5p	CLIP-seq
MIRT1224546	hsa-miR-3195	CLIP-seq
MIRT2293277	hsa-miR-3196	CLIP-seq
MIRT1224547	hsa-miR-339-5p	CLIP-seq
MIRT2293278	hsa-miR-3616-5p	CLIP-seq
MIRT2293279	hsa-miR-3622a-3p	CLIP-seq
MIRT2293280	hsa-miR-3622b-3p	CLIP-seq
MIRT2293281	hsa-miR-3647-5p	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065510	hsa-miR-3664-5p	CLIP-seq
MIRT2293282	hsa-miR-372	CLIP-seq
MIRT2293283	hsa-miR-373	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT2293285	hsa-miR-3940-3p	CLIP-seq
MIRT1224552	hsa-miR-4252	CLIP-seq
MIRT1224555	hsa-miR-4284	CLIP-seq
MIRT2293286	hsa-miR-4293	CLIP-seq
MIRT2065511	hsa-miR-4320	CLIP-seq
MIRT1224558	hsa-miR-4421	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2293287	hsa-miR-4488	CLIP-seq
MIRT2065514	hsa-miR-455-3p	CLIP-seq
MIRT2065515	hsa-miR-4634	CLIP-seq
MIRT2065516	hsa-miR-4639-3p	CLIP-seq
MIRT2293288	hsa-miR-4697-5p	CLIP-seq
MIRT2293289	hsa-miR-4731-5p	CLIP-seq
MIRT2293290	hsa-miR-4749-3p	CLIP-seq
MIRT2293291	hsa-miR-4763-5p	CLIP-seq
MIRT1224574	hsa-miR-4786-5p	CLIP-seq
MIRT1224575	hsa-miR-4793-3p	CLIP-seq
MIRT2293292	hsa-miR-4795-5p	CLIP-seq
MIRT2065520	hsa-miR-484	CLIP-seq
MIRT1224576	hsa-miR-508-5p	CLIP-seq
MIRT2065522	hsa-miR-510	CLIP-seq
MIRT2293293	hsa-miR-512-3p	CLIP-seq
MIRT2293294	hsa-miR-520a-3p	CLIP-seq
MIRT2293295	hsa-miR-520b	CLIP-seq
MIRT2293296	hsa-miR-520c-3p	CLIP-seq
MIRT2293297	hsa-miR-520d-3p	CLIP-seq
MIRT2293298	hsa-miR-520e	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2293300	hsa-miR-573	CLIP-seq
MIRT2293301	hsa-miR-596	CLIP-seq
MIRT1224578	hsa-miR-612	CLIP-seq
MIRT1224581	hsa-miR-661	CLIP-seq
MIRT2293302	hsa-miR-663b	CLIP-seq
MIRT2065524	hsa-miR-668	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2293303	hsa-miR-874	CLIP-seq
MIRT2065504	hsa-miR-3135b	CLIP-seq
MIRT2392368	hsa-miR-3158-3p	CLIP-seq
MIRT2392369	hsa-miR-3612	CLIP-seq
MIRT2065509	hsa-miR-3652	CLIP-seq
MIRT2065512	hsa-miR-4430	CLIP-seq
MIRT2392370	hsa-miR-4443	CLIP-seq
MIRT2392371	hsa-miR-4446-3p	CLIP-seq
MIRT2392372	hsa-miR-4492	CLIP-seq
MIRT2392373	hsa-miR-4498	CLIP-seq
MIRT2392374	hsa-miR-4717-5p	CLIP-seq
MIRT2392375	hsa-miR-650	CLIP-seq
MIRT2392376	hsa-miR-762	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456228	hsa-miR-3925-3p	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2456234	hsa-miR-549	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT2591312	hsa-miR-1273e	CLIP-seq
MIRT2591313	hsa-miR-146a	CLIP-seq
MIRT2591314	hsa-miR-146b-5p	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2456228	hsa-miR-3925-3p	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2456234	hsa-miR-549	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq
MIRT2591312	hsa-miR-1273e	CLIP-seq
MIRT2591313	hsa-miR-146a	CLIP-seq
MIRT2591314	hsa-miR-146b-5p	CLIP-seq
MIRT2456227	hsa-miR-3675-3p	CLIP-seq
MIRT2293284	hsa-miR-3926	CLIP-seq
MIRT1224560	hsa-miR-4459	CLIP-seq
MIRT2456229	hsa-miR-4662a-5p	CLIP-seq
MIRT2456230	hsa-miR-4676-5p	CLIP-seq
MIRT2456231	hsa-miR-4684-5p	CLIP-seq
MIRT1224572	hsa-miR-4695-5p	CLIP-seq
MIRT2456232	hsa-miR-4755-3p	CLIP-seq
MIRT2065519	hsa-miR-4768-3p	CLIP-seq
MIRT2456233	hsa-miR-548c-3p	CLIP-seq
MIRT2293299	hsa-miR-548s	CLIP-seq
MIRT2456235	hsa-miR-575	CLIP-seq
MIRT1224580	hsa-miR-658	CLIP-seq
MIRT1224582	hsa-miR-665	CLIP-seq
MIRT1224583	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
GATA2	Unknown	9028949

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	15985432, 26706435
GO:0002576	Process	Platelet degranulation	TAS
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9162084, 9312087, 9774457, 10704309, 10801826, 15985432, 17580308, 18672896, 25241761, 26607202, 28514442, 32814053
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	IDA	17464107
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005911	Component	Cell-cell junction	IDA	15572031
GO:0006909	Process	Phagocytosis	IDA	12110892
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IMP	27958302
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	17580308
GO:0007165	Process	Signal transduction	TAS	7994021
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0008037	Process	Cell recognition	TAS	1690453
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0032991	Component	Protein-containing complex	IDA	26607202
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0035696	Process	Monocyte extravasation	IMP	11078691
GO:0042803	Function	Protein homodimerization activity	IDA	26702061, 27958302
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045121	Component	Membrane raft	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	26706435
GO:0050900	Process	Leukocyte migration	TAS
GO:0050904	Process	Diapedesis	IDA	19342684
GO:0061028	Process	Establishment of endothelial barrier	IMP	7589563
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070830	Process	Bicellular tight junction assembly	IMP	26607202
GO:0072011	Process	Glomerular endothelium development	IEP	17464107
GO:0072672	Process	Neutrophil extravasation	IMP	17580308, 22266279
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA	21873635
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IMP	17580308
GO:0150107	Process	Positive regulation of protein localization to cell-cell junction	IDA	26706435

MIM	HGNC	e!Ensembl
173445	8823	ENSG00000261371

Protein

UniProt ID

P16284

Protein name

Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31)

Protein function

Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions (PubMed:17580308, PubMed:19342684). Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECA

PDB

2KY5 , 5C14 , 5GNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	327 → 404	Immunoglobulin domain	Domain
PF17736	Ig_C17orf99	409 → 496	C17orf99 Ig domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on platelets and leukocytes and is primarily concentrated at the borders between endothelial cells (PubMed:18388311, PubMed:21464369). Expressed in human umbilical vein endothelial cells (HUVECs) (at protein level) (PubMed:17

Sequence

MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT

Sequence length

738

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Cell adhesion molecules Leukocyte transendothelial migration Malaria Fluid shear stress and atherosclerosis		Platelet degranulation Cell surface interactions at the vascular wall PECAM1 interactions Integrin cell surface interactions Platelet sensitization by LDL Neutrophil degranulation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	17509538
Autoimmune diseases	Autoimmune Diseases	rs869025224	10848805
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	28530674, 29212778

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Coronary heart disease	Coronary heart disease	21378988	ClinVar
Coronary Heart Disease	Coronary Heart Disease		GWAS
Myocardial Infarction	Myocardial Infarction		GWAS
Alzheimer disease	Alzheimer disease		GWAS

Show/Hide Text Mining Associations (213)

Disease Name	Relationship Type	References
Associations from Text Mining
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	30808776
Abortion Habitual	Inhibit	33390589
Acute Coronary Syndrome	Associate	29211854
Acute Coronary Syndrome	Stimulate	35109843
Acute Disease	Associate	8532023
Adenocarcinoma	Associate	17965528
Adenocarcinoma of Lung	Associate	31592232, 32578582, 33062704, 33461176, 33511215, 33661044, 35635202, 36529788, 36688087
Adenomatous Polyposis Coli	Associate	33108070
Adrenocortical Carcinoma	Associate	28695321
alpha Thalassemia	Associate	32482310
Alzheimer Disease	Associate	30007166
Angina Unstable	Associate	25267411
Angiokeratoma	Associate	31169171
Aortic Diseases	Associate	35460403
Arteriovenous Malformations	Associate	36012380
Arthritis Juvenile	Associate	23686519, 30127787
Arthritis Psoriatic	Associate	23303013
Arthritis Rheumatoid	Associate	15593185, 32365786
Asthma	Associate	23264403, 35858526
Atherosclerosis	Associate	27997991, 32323830
Bacterial Infections	Stimulate	34112226
Balkan Nephropathy	Associate	22977664
beta Thalassemia	Associate	27228385
Bicuspid Aortic Valve Disease	Associate	37162557
Blood Loss Surgical	Inhibit	33636040
Brain Neoplasms	Associate	26277786, 32795351
Breast Neoplasms	Associate	18225549, 23139263, 31128060, 31535669, 32305991, 39235656
Bronchiolitis Obliterans Syndrome	Associate	11669217, 25460358
Bronchiolitis Obliterans Syndrome	Inhibit	27994216
Calcinosis Cutis	Associate	17429142
Carcinogenesis	Associate	33108070, 34358255
Carcinoma	Stimulate	29085834
Carcinoma Ductal Breast	Associate	12651608
Carcinoma Hepatocellular	Associate	22713659, 24045661
Carcinoma Intraductal Noninfiltrating	Associate	11953822, 12651608
Carcinoma Merkel Cell	Associate	30808776
Carcinoma Non Small Cell Lung	Associate	23369236, 34455700, 34633989, 39272978, 40252985
Carcinoma Non Small Cell Lung	Inhibit	36688087
Carcinoma Pancreatic Ductal	Associate	27637082, 30718678
Carcinoma Renal Cell	Stimulate	17510564
Carcinoma Renal Cell	Associate	24086736, 26821530, 27031776, 31850854, 34358255
Carcinoma Squamous Cell	Associate	16681757, 17965528, 35761838
Cardiomyopathies	Associate	37982389
Cardiomyopathy Dilated	Inhibit	29115553
Cardiovascular Diseases	Associate	25267411, 32119531
Cerebral Amyloid Angiopathy	Inhibit	30007166
Cerebral Infarction	Inhibit	37495324
Cerebrovascular Disorders	Associate	30321232
Chagas Disease	Stimulate	11309161
Cholangiocarcinoma	Associate	29031565
Chronic Disease	Associate	32260158
Chronic Periodontitis	Associate	23264219, 30922293
Colitis Ulcerative	Associate	37055495
Colitis Ulcerative	Stimulate	7900941
Colonic Diseases	Associate	24236063
Colorectal Neoplasms	Associate	23963148, 36327819, 37986009
Corneal Endothelial Cell Loss	Associate	30236159
Coronary Artery Disease	Associate	24339880, 25267411, 28512385
Coronary Disease	Associate	27997991
COVID 19	Stimulate	33979758
COVID 19	Associate	36334414
Cysts	Associate	27442396
Death	Associate	35239653
Dental Plaque	Associate	25170063
Diabetes Gestational	Associate	28817576
Diabetes Mellitus	Associate	22916176, 30321232
Diabetes Mellitus Type 2	Associate	28116228
Diabetes Mellitus Type 2	Inhibit	35109843
Diabetic Nephropathies	Inhibit	17264876
Diabetic Nephropathies	Associate	28116228
Disease Progression	Associate	18794102
Drug Related Side Effects and Adverse Reactions	Associate	34941730
End Stage Liver Disease	Associate	33253099
Endometriosis	Associate	28158750
Enhanced S Cone Syndrome	Associate	35940591
Epidermodysplasia Verruciformis	Associate	35202881
Epstein Barr Virus Infections	Inhibit	11168811
Esophageal Neoplasms	Associate	24777337
Esophageal Squamous Cell Carcinoma	Stimulate	24777337
Farber Lipogranulomatosis	Stimulate	31646818
Gastro enteropancreatic neuroendocrine tumor	Associate	21245995
Gastrointestinal Stromal Tumors	Associate	26078569
Glaucoma Open Angle	Associate	16565384
Glioblastoma	Associate	33249476
Glomerulonephritis IGA	Associate	10193431, 34861820
Glomerulonephritis IGA	Inhibit	37170272
Glomerulonephritis Membranous	Associate	9551397
Glucosephosphate Dehydrogenase Deficiency	Associate	19008126, 26360820, 32945351
Graft vs Host Disease	Associate	11564091, 11669217, 17178660, 8532023, 8977234
Graft vs Host Disease	Inhibit	19539218
Granuloma	Associate	1605306
Granuloma Giant Cell	Associate	30139237
Graves Disease	Stimulate	7586686
Guillain Barre Syndrome	Associate	34763483
Hashimoto Disease	Associate	7586686
Heart Failure	Associate	21935395, 33874740, 36761158
Heart Failure	Inhibit	29784904
Hemangioendothelioma	Associate	27515856
Hemangioma	Associate	32094426
Hemangioma capillary infantile	Associate	39337249
Hemangioma Cavernous Central Nervous System	Stimulate	20809761
Hemangiosarcoma	Associate	29084920, 30723294, 32795351, 35440765
Hematologic Neoplasms	Associate	12842710, 17106245
Hemorrhage	Associate	24225899
Hemorrhoids	Associate	40114371
Hemostatic Disorders	Associate	30321232
Hepatitis B Chronic	Associate	28231294, 7706478
Hepatitis C	Inhibit	26232733
Hepatitis C Chronic	Associate	33912168
Histiocytoma Angiomatoid Fibrous	Associate	26261484
Histiocytosis Langerhans Cell	Associate	12653580
Histiocytosis with joint contractures and sensorineural deafness	Associate	12653580
HIV Infections	Associate	19131896, 21298072
Hodgkin Disease	Associate	1605306
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	37042872
Hyperoxia	Inhibit	30095998
Hypertension	Associate	32888289, 33530152
Hypoglycemia	Associate	21930598
Hypoxia	Associate	27488544
Hypoxia	Inhibit	27627890
Hypoxia Brain	Associate	33249476
Immune System Diseases	Associate	31398453
Immunologic Deficiency Syndromes	Associate	27213335
Infertility	Inhibit	38274228
Infertility Female	Inhibit	38274228
Inflammation	Associate	10643715, 23443553, 25793984, 28116228, 30127787, 33272162, 34265605, 35880176
Inflammatory Bowel Diseases	Associate	27552332
Intracranial Arteriovenous Malformations	Associate	10702408
Intracranial Arteriovenous Malformations	Stimulate	39682704
Kaposiform Hemangioendothelioma	Associate	37978357
Keloid	Associate	22509836, 36316928
Kidney Neoplasms	Associate	31850854
Klatskin Tumor	Associate	26657503
Leiomyoma	Associate	37400623, 37487574
Leishmaniasis	Associate	23440109
Leukemia	Associate	12673718, 23180012
Leukemia Lymphocytic Chronic B Cell	Associate	12673718, 15613544, 19383907, 27226587, 9885225
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21535879, 23180012
Leukemia Prolymphocytic T Cell	Associate	20813004
Lichen Planus Oral	Associate	32436909
Lipoma	Associate	16594742
Liver Neoplasms	Associate	27090685
Lung Diseases	Associate	22246909
Lymphatic Metastasis	Associate	15297858, 16681757
Lymphoma B Cell Marginal Zone	Associate	16610000
Lymphoma Non Hodgkin	Associate	16610000
Lymphopenia	Associate	33912168
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	17935071
Macular Degeneration	Stimulate	36899935
Melanoma	Associate	17429142, 37240247
Melanoma Cutaneous Malignant	Associate	17429142
Metabolic Syndrome	Associate	36327819
Mitral Valve Prolapse	Associate	27213335
Mouth Diseases	Associate	15482790
Mucocutaneous Lymph Node Syndrome	Associate	17456996, 28512385
Multiple Myeloma	Associate	11532348
Multiple Sclerosis Relapsing Remitting	Associate	16412055
Myocardial Infarction	Associate	23274712
Myocardial Infarction	Stimulate	28213360
Nasal Polyps	Stimulate	33135871
Neoplasm Metastasis	Associate	17409853, 23774169, 34358255, 37553013, 39247989
Neoplasms	Associate	10926791, 11836450, 12651608, 14514775, 16168127, 16520280, 16610000, 16681757, 17106245, 17429142, 18219095, 18652591, 18710985, 18794102, 22246909 View all (33 more)
Neoplasms	Inhibit	36688087
Neoplasms Cystic Mucinous and Serous	Stimulate	29085834
Neoplasms Squamous Cell	Associate	24225899
Obesity	Inhibit	29784904
Obesity	Associate	37219669
Odontogenic Tumors	Associate	26247531
Osteoporosis	Associate	22226689
Osteosarcoma	Associate	24548763
Ovarian Diseases	Associate	28158750
Ovarian Neoplasms	Associate	34783299
Pancreatic Neoplasms	Associate	30718678
Parkinson Disease	Associate	23054369
Pediatric Obesity	Inhibit	26232733
Peri Implantitis	Stimulate	28158750
Periapical Diseases	Associate	28290616
Periodontitis	Associate	36148415, 38157091
Personality Disorders	Associate	17429142
Philadelphia Chromosome	Associate	23233201
Plasmacytoma anaplastic	Associate	12930383, 9378815
Pneumococcal Infections	Inhibit	37358300
Polyps	Associate	21119367
Polyps	Stimulate	33108070
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17638851
Proctitis	Associate	23737650
Prostatic Neoplasms	Associate	18767028, 23978847, 28552967, 33370412
Psoriasis	Stimulate	24584739
Pulmonary Arterial Hypertension	Associate	18029384
Pulmonary Disease Chronic Obstructive	Associate	23635004, 27784320
Renal Insufficiency Chronic	Associate	19406964
Respiratory Tract Infections	Associate	22977664
Rheumatoid Nodule	Associate	9797554
Rufous oculocutaneous albinism	Inhibit	19539218
Sarcoma	Associate	26191309, 35440765
Scleroderma Systemic	Stimulate	18029384
Scleroderma Systemic	Associate	27159521, 33253099
Small Cell Lung Carcinoma	Associate	37553013
Squamous Cell Carcinoma of Head and Neck	Associate	31744214, 32334476
ST Elevation Myocardial Infarction	Associate	35880176
Status Asthmaticus	Associate	21205894, 23264403
Stomach Diseases	Associate	16610000
Stomach Neoplasms	Associate	14606068, 30833656, 38050283
Synovitis	Associate	30127787
Thalassemia	Associate	27228385
Thrombasthenia	Associate	8080982
Thrombosis	Associate	38236412
Thymus Neoplasms	Associate	16594742
Thyroiditis Autoimmune	Stimulate	18637101
Urinary Bladder Neoplasms	Associate	27716046, 33238953
Uterine Cervical Neoplasms	Associate	19110305
Uterine Diseases	Associate	21119367
Vascular Diseases	Associate	28213360

PECAM1 (platelet and endothelial cell adhesion molecule 1)