Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51741
Gene name Gene Name - the full gene name approved by the HGNC.
WW domain containing oxidoreductase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WWOX
Synonyms (NCBI Gene) Gene synonyms aliases
D16S432E, DEE28, EIEE28, FOR, FRA16D, HHCMA56, PRO0128, SCAR12, SDR41C1, WOX1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.1-q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induc
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs75559202 C>G Benign, pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs79771882 G>A Benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant, genic downstream transcript variant
rs117209694 C>G,T Likely-benign, uncertain-significance, pathogenic Synonymous variant, coding sequence variant, genic downstream transcript variant, missense variant
rs119487098 T>C Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs140817689 G>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT736037 hsa-miR-92a-3p Luciferase reporter assay, Western blotting, qRT-PCR 31456594
MIRT1494822 hsa-miR-1302 CLIP-seq
MIRT1494823 hsa-miR-149 CLIP-seq
MIRT1494824 hsa-miR-2115 CLIP-seq
MIRT1494825 hsa-miR-2116 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
E2F1 Repression 15044096
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001649 Process Osteoblast differentiation IEA
GO:0003713 Function Transcription coactivator activity IEA
GO:0003713 Function Transcription coactivator activity ISS 19366691
GO:0005515 Function Protein binding IPI 15064722, 15070730, 15580310, 16061658, 19465938, 25678599, 30285739, 32296183, 32814053, 33961781, 34819669
GO:0005634 Component Nucleus IDA 19366691
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605131 12799 ENSG00000186153
Protein
UniProt ID Q9NZC7
Protein name WW domain-containing oxidoreductase (EC 1.1.1.-) (Fragile site FRA16D oxidoreductase) (Short chain dehydrogenase/reductase family 41C member 1)
Protein function Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. Required for normal bone development (By similarity). May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in T
PDB 1WMV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00397 WW 18 47 WW domain Domain
PF00397 WW 59 88 WW domain Domain
PF00106 adh_short 125 268 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Strongly expressed in testis, prostate, and ovary. Overexpressed in cancer cell lines. Isoform 5 and isoform 6 may only be expressed in tumor cell lines. {ECO:0000269|PubMed:10786676, ECO:0000269|PubMed:11719429}.
Sequence
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQVFFVDHINKRTTYLDP
RLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAM
TLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSAPARVIVVSSESHRFTDI
NDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCN
ILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTV
YCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG
Sequence length 414
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear signaling by ERBB4
Negative regulation of activity of TFAP2 (AP-2) family transcription factors
Activation of the TFAP2 (AP-2) family of transcription factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 28, Developmental and epileptic encephalopathy, 1 rs1057518795, rs587777248, rs1060502727, rs730880290, rs1064795117, rs730880291, rs201008667, rs730880292, rs1555532979, rs730882215, rs1164465811, rs1300924648, rs368928190, rs1597207871, rs1597216056
View all (2 more)
N/A
Epileptic encephalopathy epileptic encephalopathy rs759766243, rs1057518795 N/A
Spinocerebellar Ataxia Autosomal recessive spinocerebellar ataxia 12 rs587777128, rs751181600, rs587777127 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anorexia Anorexia nervosa N/A N/A GWAS
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34948746
Aging Premature Associate 34852950
Alzheimer Disease Associate 22193544, 34852950, 35627222, 36553611, 38232788, 40139278
Arteriolosclerosis Associate 34852950
Astrocytoma Associate 24503545
Ataxia Associate 25802472
Autism Spectrum Disorder Associate 27569545, 32081867
Autistic Disorder Associate 37583270
Bicuspid Aortic Valve Disease Associate 36071494
Brain Diseases Associate 27495153, 29852413, 30362252, 34268881, 37974179