PDZK1 (PDZ domain containing 1)

Gene

• Entrez ID: 5174
• Gene name: PDZ domain containing 1
• Gene symbol: PDZK1
• Synonyms (NCBI Gene): CAP70, CLAMP, NHERF-3, NHERF3, PDZD1
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: This gene encodes a PDZ domain-containing scaffolding protein. PDZ domain-containing molecules bind to and mediate the subcellular localization of target proteins. The encoded protein mediates the localization of cell surface proteins and plays a critical

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019323	hsa-miR-148b-3p	Microarray	17612493
MIRT021465	hsa-miR-9-5p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005124	Function	Scavenger receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12471024, 15304510, 15523054, 16141316, 16189514, 17990980, 30604288, 32814053, 33436498, 34189428, 34835087
GO:0005886	Component	Plasma membrane	IDA	29752999
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005903	Component	Brush border	IDA	9461128
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030165	Function	PDZ domain binding	IPI	16236806, 16738539
GO:0031526	Component	Brush border membrane	ISS	15523054
GO:0031528	Component	Microvillus membrane	IEA
GO:0043495	Function	Protein-membrane adaptor activity	IBA
GO:0044070	Process	Regulation of monoatomic anion transport	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0141109	Function	Transporter activator activity	IDA	15523054
GO:1902603	Process	Carnitine transmembrane transport	IDA	15523054
GO:1905477	Process	Positive regulation of protein localization to membrane	IMP	29752999
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	NAS	16738539

Other IDs

• MIM: 603831
• HGNC: 8821
• e!Ensembl: ENSG00000174827

Protein

• UniProt ID: Q5T2W1
• Protein name: Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (NHERF-3) (CFTR-associated protein of 70 kDa) (Na(+)/H(+) exchanger regulatory factor 3) (Na/Pi cotransporter C-terminal-associated protein 1) (NaPi-Cap1) (PDZ domain-containing protein 1) (Sodium-hydrogen e
• Protein function: A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion t
• PDB: 2EEI, 2EEJ, 2VSP, 3TMH, 4Q2P, 6EZI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	9 → 87	PDZ domain	Domain
  PF00595	PDZ	137 → 212	PDZ domain	Domain
  PF00595	PDZ	242 → 320	PDZ domain	Domain
  PF17820	PDZ_6	402 → 456	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expression is limited to epithelial cells. Expressed in the kidney (brush border of proximal tubule), pancreas, liver, and small intestine. Expressed at a lower level in the adrenal cortex, testis and stomach. Overexpressed in breast,
• Sequence:

  MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRING
  VFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILS
  PVMNGGVQTWTQPRLCYLVKEGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHL
  IEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQ
  PRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVETLD
  HDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSL
  EVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDE
  DVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDT
  PPDSKEGIVVESNHDSHMAKERAHSTASHSSSNSEDTEM

• Sequence length: 519