Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51734
Gene name	Methionine sulfoxide reductase B1
Gene symbol	MSRB1
Synonyms (NCBI Gene)	HSPC270SELENORSELENOXSELRSELXSEPX1SepR
Chromosome	16
Chromosome location	16p13.3
Summary	The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methi

Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045669	hsa-miR-149-5p	CLASH	23622248
MIRT656122	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT656120	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT656121	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT656119	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT656118	hsa-miR-8081	HITS-CLIP	23824327
MIRT515286	hsa-miR-296-3p	PAR-CLIP	23446348
MIRT515285	hsa-miR-4755-3p	PAR-CLIP	23446348
MIRT515284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT515283	hsa-miR-548s	PAR-CLIP	23446348
MIRT515282	hsa-miR-588	PAR-CLIP	23446348
MIRT515281	hsa-miR-4435	PAR-CLIP	23446348
MIRT515280	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT515279	hsa-miR-5096	PAR-CLIP	23446348
MIRT656122	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT656120	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT656121	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT656119	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT656118	hsa-miR-8081	HITS-CLIP	23824327
MIRT515286	hsa-miR-296-3p	PAR-CLIP	23446348
MIRT515285	hsa-miR-4755-3p	PAR-CLIP	23446348
MIRT515284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT515283	hsa-miR-548s	PAR-CLIP	23446348
MIRT515282	hsa-miR-588	PAR-CLIP	23446348
MIRT515281	hsa-miR-4435	PAR-CLIP	23446348
MIRT515280	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT515279	hsa-miR-5096	PAR-CLIP	23446348

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	23805218, 28579431, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS	14699060
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030041	Process	Actin filament polymerization	ISS
GO:0030091	Process	Protein repair	IBA
GO:0030091	Process	Protein repair	IEA
GO:0030091	Process	Protein repair	ISS	14699060
GO:0030091	Process	Protein repair	TAS
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	IBA
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	IEA
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	ISS
GO:0033743	Function	Peptide-methionine (R)-S-oxide reductase activity	TAS
GO:0033745	Function	L-methionine-(R)-S-oxide reductase activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606216	14133	ENSG00000198736

Q9NZV6

Protein name

Methionine-R-sulfoxide reductase B1 (MsrB1) (EC 1.8.4.12) (EC 1.8.4.14) (Selenoprotein X) (SelX)

Protein function

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-tra

PDB

3MAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01641	SelR	5 → 105	SelR domain	Family

Sequence

MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
HNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH

Sequence length

116

Interactions

View interactions

	Reactome
			Protein repair

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	23805218, 36497178	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	17519015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34719306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25541970, 34719306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	36497178	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	37033956	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	34719306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	25541970	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	37336980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Associate	37336980	★★★★★ ★☆☆☆☆ Found in Text Mining only

MSRB1 (methionine sulfoxide reductase B1)