Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51704
Gene name	G protein-coupled receptor class C group 5 member B
Gene symbol	GPRC5B
Synonyms (NCBI Gene)	MLC3RAIG-2RAIG2
Chromosome	16
Chromosome location	16p12.3
Summary	This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is a

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT557471	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT557470	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT557469	hsa-miR-636	PAR-CLIP	21572407
MIRT557468	hsa-miR-2113	PAR-CLIP	21572407
MIRT498385	hsa-miR-4523	PAR-CLIP	22291592
MIRT498384	hsa-miR-512-5p	PAR-CLIP	22291592
MIRT498383	hsa-miR-212-5p	PAR-CLIP	22291592
MIRT498382	hsa-miR-5189-3p	PAR-CLIP	22291592
MIRT498381	hsa-miR-3926	PAR-CLIP	22291592
MIRT498380	hsa-miR-548s	PAR-CLIP	22291592
MIRT498379	hsa-miR-4701-5p	PAR-CLIP	22291592
MIRT498378	hsa-miR-588	PAR-CLIP	22291592
MIRT498377	hsa-miR-4435	PAR-CLIP	22291592
MIRT498376	hsa-miR-3187-3p	PAR-CLIP	22291592
MIRT557471	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT557470	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT557469	hsa-miR-636	PAR-CLIP	21572407
MIRT557468	hsa-miR-2113	PAR-CLIP	21572407
MIRT498385	hsa-miR-4523	PAR-CLIP	22291592
MIRT498384	hsa-miR-512-5p	PAR-CLIP	22291592
MIRT498383	hsa-miR-212-5p	PAR-CLIP	22291592
MIRT498382	hsa-miR-5189-3p	PAR-CLIP	22291592
MIRT498381	hsa-miR-3926	PAR-CLIP	22291592
MIRT498380	hsa-miR-548s	PAR-CLIP	22291592
MIRT498379	hsa-miR-4701-5p	PAR-CLIP	22291592
MIRT498378	hsa-miR-588	PAR-CLIP	22291592
MIRT498377	hsa-miR-4435	PAR-CLIP	22291592
MIRT498376	hsa-miR-3187-3p	PAR-CLIP	22291592
MIRT1032223	hsa-miR-187	CLIP-seq
MIRT1032224	hsa-miR-200b	CLIP-seq
MIRT1032225	hsa-miR-200c	CLIP-seq
MIRT1032226	hsa-miR-338-3p	CLIP-seq
MIRT1032227	hsa-miR-429	CLIP-seq
MIRT1032228	hsa-miR-4450	CLIP-seq
MIRT1032229	hsa-miR-4490	CLIP-seq
MIRT1032230	hsa-miR-450b-5p	CLIP-seq
MIRT1032231	hsa-miR-4527	CLIP-seq
MIRT1032232	hsa-miR-4530	CLIP-seq
MIRT1032233	hsa-miR-4706	CLIP-seq
MIRT1032234	hsa-miR-4749-5p	CLIP-seq
MIRT1032235	hsa-miR-4774-5p	CLIP-seq
MIRT1032236	hsa-miR-542-5p	CLIP-seq
MIRT1032237	hsa-miR-744	CLIP-seq
MIRT1032238	hsa-miR-939	CLIP-seq
MIRT2238672	hsa-miR-1910	CLIP-seq
MIRT2238673	hsa-miR-455-3p	CLIP-seq
MIRT2238674	hsa-miR-4707-5p	CLIP-seq
MIRT2238675	hsa-miR-510	CLIP-seq
MIRT2238676	hsa-miR-9	CLIP-seq
MIRT1032238	hsa-miR-939	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006884	Process	Cell volume homeostasis	IMP	37143309
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	ISS
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0030295	Function	Protein kinase activator activity	IDA	23169819
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043235	Component	Receptor complex	IBA
GO:0045121	Component	Membrane raft	IDA	23169819
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IBA
GO:0070062	Component	Extracellular exosome	IDA	21557262
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	23169819

MIM	HGNC	e!Ensembl
605948	13308	ENSG00000167191

Q9NZH0

Protein name

G-protein coupled receptor family C group 5 member B (A-69G12.1) (Retinoic acid-induced gene 2 protein) (RAIG-2)

Protein function

G-protein coupled receptor involved in the regulation of cell volume.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00003	7tm_3	67 → 294	7 transmembrane sweet-taste receptor of 3 GCPR	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is high in kidney, pancreas, and testis, medium in brain, heart, prostate, small intestine, and spleen, low in liver, placenta, skeletal muscle, colon, ovary, and thymus, and not detectable in lung and peripheral leukocyte.

Sequence

MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET
ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW
LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA
FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS
GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW

Sequence length

403

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Megalencephalic leukoencephalopathy with subcortical cysts 3	Pathogenic	rs2506973258, rs2506973246	RCV003315380 RCV003315381	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANAL POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	34857756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Associate	37143309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	34857756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Inhibit	35046932	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	37686013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Stimulate	36682796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	36682796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Megalencephalic leukoencephalopathy with subcortical cysts	Associate	37143309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31659097, 36682796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	36682796	★★★★★ ★☆☆☆☆ Found in Text Mining only

GPRC5B (G protein-coupled receptor class C group 5 member B)