LSM8 (LSM8 homolog, U6 small nuclear RNA associated)

Gene

• Entrez ID: 51691
• Gene name: LSM8 homolog, U6 small nuclear RNA associated
• Gene symbol: LSM8
• Synonyms (NCBI Gene): NAA38
• Chromosome: 7
• Chromosome location: 7q31.31
• Summary: This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT650261	hsa-miR-8063	HITS-CLIP	23824327
MIRT664992	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT650262	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT650261	hsa-miR-8063	HITS-CLIP	23824327
MIRT650262	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT519196	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT519195	hsa-miR-5692a	PAR-CLIP	21572407
MIRT532212	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT532211	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT532210	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT532209	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT519196	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT519195	hsa-miR-5692a	PAR-CLIP	22012620
MIRT532213	hsa-miR-8083	PAR-CLIP	22012620
MIRT532212	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT532211	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT532210	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT532209	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT532208	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT532207	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT519196	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT519195	hsa-miR-5692a	PAR-CLIP	23446348
MIRT447894	hsa-miR-6815-3p	PAR-CLIP	22100165
MIRT447893	hsa-miR-3192-3p	PAR-CLIP	22100165
MIRT447892	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447891	hsa-miR-4762-3p	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	28781166
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	NAS	30975767
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	14667819, 15231747, 19628699, 21988832, 22365833, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	26912367
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	30975767
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005681	Component	Spliceosomal complex	IPI	30975767
GO:0005688	Component	U6 snRNP	IBA
GO:0005688	Component	U6 snRNP	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0017070	Function	U6 snRNA binding	NAS	10523320
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IBA
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IDA	26912367
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IEA
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IPI	30975767
GO:0071005	Component	U2-type precatalytic spliceosome	IDA	28781166
GO:0071011	Component	Precatalytic spliceosome	IBA
GO:0120115	Component	Lsm2-8 complex	IDA	10523320
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 607288
• HGNC: 20471
• e!Ensembl: ENSG00000128534

Protein

• UniProt ID: O95777
• Protein name: U6 snRNA-associated Sm-like protein LSm8
• Protein function: Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PubMed:28781166). The heptameric LSM2-8 complex
• PDB: 3JCR, 5O9Z, 6AH0, 6AHD, 6QW6, 6QX9, 7ABG, 8H6E, 8H6J, 8H6K, 8H6L, 8QO9, 8QXD, 8QZS, 8R08, 8R09, 8R0A, 8R0B, 8RM5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01423	LSM	3 → 72	LSM domain	Domain

• Sequence:

  MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLY
  IVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

• Sequence length: 96

Pathways

KEGG:

RNA degradation
Spliceosome

Reactome:

mRNA Splicing - Major Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Non Small Cell Lung	Associate	26755624	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Associate	30926877	★☆☆☆☆ Found in Text Mining only