ASB2 (ankyrin repeat and SOCS box containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51676
Gene name Gene Name - the full gene name approved by the HGNC.
Ankyrin repeat and SOCS box containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASB2
Synonyms (NCBI Gene) Gene synonyms aliases
ASB-2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ankyrin repeat and SOCS box-containing (ASB) protein family. These proteins play a role in protein degradation by coupling suppressor of cytokine signalling (SOCS) proteins with the elongin BC complex. The encoded protein
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT018815 hsa-miR-335-5p Microarray 18185580
MIRT025902 hsa-miR-7-5p Microarray 17612493
MIRT441170 hsa-miR-218-5p HITS-CLIP 23212916
MIRT441170 hsa-miR-218-5p HITS-CLIP 23212916
MIRT733799 hsa-miR-874-3p Luciferase reporter assay, RNA-seq, qRT-PCR 33777926
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA 21873635
GO:0000151 Component Ubiquitin ligase complex IDA 16325183
GO:0005515 Function Protein binding IPI 16325183, 28514442, 32814053
GO:0005829 Component Cytosol TAS
GO:0006511 Process Ubiquitin-dependent protein catabolic process IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605759 16012 ENSG00000100628
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96Q27
Protein name Ankyrin repeat and SOCS box protein 2 (ASB-2)
Protein function Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15590664, PubMed:16325183
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13637 Ank_4 58 → 110 Repeat
PF12796 Ank_2 111 → 187 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 128 → 220 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 183 → 253 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 215 → 286 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 260 → 351 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 351 → 423 Ankyrin repeats (3 copies) Repeat
PF07525 SOCS_box 545 → 583 SOCS box Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: Expressed in muscle cells. {ECO:0000269|PubMed:19300455}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in hematopoietic cells. {ECO:0000269|PubMed:19300455}.
Sequence 
MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADP
LIKAIKDGDEEALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQR
TLQEETAVYLATCRGHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHN
ADTNHRCNRGWTALHESVSRNDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALR
FLAKYGADINTQASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKG
NYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTPLAPERARLYE
DRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANID
AYIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDA
PAADKEPSVVQFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKE
KAEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
Sequence length 587
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Spina Bifida Spina Bifida GWAS
Show/Hide Text Mining Associations (14)
Associations from Text Mining
Disease Name Relationship Type References
Chronic Disease Associate 27773939
Leukemia Associate 18799729
Leukemia Biphenotypic Acute Inhibit 22174154
Leukemia Myeloid Associate 11682484, 19376791
Leukemia Promyelocytic Acute Associate 11682484, 18799729, 19376791
Lymphoma Large B Cell Diffuse Associate 34763718
Myotonic Dystrophy Associate 29955039
Neoplasms Inhibit 30917865
Obesity Associate 27773939
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 30116272