ASB2 (ankyrin repeat and SOCS box containing 2)

Gene

• Entrez ID: 51676
• Gene name: Ankyrin repeat and SOCS box containing 2
• Gene symbol: ASB2
• Synonyms (NCBI Gene): ASB-2
• Chromosome: 14
• Chromosome location: 14q32.12
• Summary: This gene encodes a member of the ankyrin repeat and SOCS box-containing (ASB) protein family. These proteins play a role in protein degradation by coupling suppressor of cytokine signalling (SOCS) proteins with the elongin BC complex. The encoded protein

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018815	hsa-miR-335-5p	Microarray	18185580
MIRT025902	hsa-miR-7-5p	Microarray	17612493
MIRT441170	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441170	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT733799	hsa-miR-874-3p	Luciferase reporter assay, RNA-seq, qRT-PCR	33777926
MIRT733800	hsa-miR-212-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33777926
MIRT733799	hsa-miR-874-3p	Luciferase reporter assay, RNA-seq, qRT-PCR	33777926
MIRT733799	hsa-miR-874-3p	Luciferase reporter assay, RNA-seq, qRT-PCR	33777926
MIRT733800	hsa-miR-212-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33777926
MIRT802224	hsa-miR-4474-5p	CLIP-seq
MIRT802225	hsa-miR-9	CLIP-seq
MIRT802226	hsa-miR-1184	CLIP-seq
MIRT802227	hsa-miR-1321	CLIP-seq
MIRT802228	hsa-miR-1827	CLIP-seq
MIRT802229	hsa-miR-3612	CLIP-seq
MIRT802230	hsa-miR-4739	CLIP-seq
MIRT802231	hsa-miR-4756-5p	CLIP-seq
MIRT802232	hsa-miR-596	CLIP-seq
MIRT802233	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	16325183, 24044920
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0001725	Component	Stress fiber	IEA
GO:0001947	Process	Heart looping	IEA
GO:0005515	Function	Protein binding	IPI	16325183, 21119685, 28514442
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	24044920
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0007165	Process	Signal transduction	TAS	9419338
GO:0014732	Process	Skeletal muscle atrophy	ISS
GO:0016567	Process	Protein ubiquitination	IDA	16325183
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030018	Component	Z disc	IEA
GO:0030018	Component	Z disc	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0036336	Process	Dendritic cell migration	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21119685
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IMP	32179481
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0055013	Process	Cardiac muscle cell development	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	16325183
GO:0071800	Process	Podosome assembly	ISS
GO:0097602	Function	Cullin family protein binding	IPI	21119685
GO:2000812	Process	Regulation of barbed-end actin filament capping	IBA

Other IDs

• MIM: 605759
• HGNC: 16012
• e!Ensembl: ENSG00000100628

Protein

• UniProt ID: Q96Q27
• Protein name: Ankyrin repeat and SOCS box protein 2 (ASB-2)
• Protein function: Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15590664, PubMed:16325183
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13637	Ank_4	58 → 110		Repeat
  PF12796	Ank_2	111 → 187	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	128 → 220	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	183 → 253	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	215 → 286	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	260 → 351	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	351 → 423	Ankyrin repeats (3 copies)	Repeat
  PF07525	SOCS_box	545 → 583	SOCS box	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed in muscle cells. {ECO:0000269|PubMed:19300455}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in hematopoietic cells. {ECO:0000269|PubMed:19300455}.
• Sequence:

  MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADP
  LIKAIKDGDEEALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQR
  TLQEETAVYLATCRGHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHN
  ADTNHRCNRGWTALHESVSRNDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALR
  FLAKYGADINTQASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKG
  NYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTPLAPERARLYE
  DRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANID
  AYIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDA
  PAADKEPSVVQFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKE
  KAEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ

• Sequence length: 587

Pathways

Reactome:

Neddylation
Antigen processing: Ubiquitination & Proteasome degradation