Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51659
Gene name Gene Name - the full gene name approved by the HGNC.
GINS complex subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GINS2
Synonyms (NCBI Gene) Gene synonyms aliases
HSPC037, PSF2, Pfs2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extract
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016400 hsa-miR-193b-3p Microarray 20304954
MIRT040250 hsa-miR-615-3p CLASH 23622248
MIRT677709 hsa-miR-625-3p HITS-CLIP 23824327
MIRT677708 hsa-miR-22-3p HITS-CLIP 23824327
MIRT677707 hsa-miR-1295b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000727 Process Double-strand break repair via break-induced replication IBA 21873635
GO:0000811 Component GINS complex IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 17525332, 22540012, 24299456, 25416956, 31515488, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0006271 Process DNA strand elongation involved in DNA replication TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610609 24575 ENSG00000131153
Protein
UniProt ID Q9Y248
Protein name DNA replication complex GINS protein PSF2 (GINS complex subunit 2)
Protein function Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks (PubMed:17417653). GINS complex is a core component of CDC45-MCM-GINS (CM
PDB 2E9X , 2EHO , 2Q9Q , 6XTX , 6XTY , 7PFO , 7PLO , 8B9D , 8OK2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05916 Sld5 42 153 GINS complex protein Family
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEI
NTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF
Sequence length 185
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Unwinding of DNA
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 16762588
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 24377518
Breast Neoplasms Associate 21082043, 24273454, 34629365, 36466552
Breast Neoplasms Stimulate 33725952
Carcinoma Hepatocellular Associate 24273454
Carcinoma Non Small Cell Lung Stimulate 32181475
Carcinoma Squamous Cell Associate 28405687, 36466552
Celiac Disease Associate 1570316
Colorectal Neoplasms Associate 35137928, 35496037, 37945594
Craniosynostoses Associate 34353863
Diabetes Mellitus Type 1 Associate 1570316