Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51642
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial ribosomal protein L48
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRPL48
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-118, HSPC290, L48MT, MRP-L48, mL48
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2274768 hsa-miR-1224-5p CLIP-seq
MIRT2274769 hsa-miR-1225-5p CLIP-seq
MIRT2274770 hsa-miR-1271 CLIP-seq
MIRT2274771 hsa-miR-182 CLIP-seq
MIRT2274772 hsa-miR-193a-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20601428
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 28892042
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611853 16653 ENSG00000175581
Protein
UniProt ID Q96GC5
Protein name Large ribosomal subunit protein mL48 (39S ribosomal protein L48, mitochondrial) (L48mt) (MRP-L48)
PDB 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH7 , 7QI4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00338 Ribosomal_S10 92 187 Ribosomal protein S10p/S20e Family
Sequence
MSGTLEKVLCLRNNTIFKQAFSLLRFRTSGEKPIYSVGGILLSISRPYKTKPTHGIGKYK
HLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK
VEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHERVVQISGLSATFAEIFLEIIQSSLPE
GVRLSVK
EHTEEDFKGRFKARPELEELLAKLK
Sequence length 212
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial translation elongation
Mitochondrial translation termination
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer These findings revealed that MMP15, MRPL48, CALN1 and HADHB genes knockout might facilitate the sensitivity of CRC cell line Caco-2 to CTX. 33048115 CBGDA
Mental Depression Major depressive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 20231622
Carcinoma Hepatocellular Stimulate 38093387
Colorectal Neoplasms Associate 33048115
Colorectal Neoplasms Stimulate 38093387
Osteosarcoma Associate 38093387
Retinoblastoma Associate 38093387