Gene Gene information from NCBI Gene database.
Entrez ID 51635
Gene name Dehydrogenase/reductase 7
Gene symbol DHRS7
Synonyms (NCBI Gene)
CGI-86SDR34C1retDSR4retSDR4
Chromosome 14
Chromosome location 14q23.1
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a
miRNA miRNA information provided by mirtarbase database.
47
miRTarBase ID miRNA Experiments Reference
MIRT935006 hsa-miR-1470 CLIP-seq
MIRT935007 hsa-miR-1825 CLIP-seq
MIRT935008 hsa-miR-199a-5p CLIP-seq
MIRT935009 hsa-miR-199b-5p CLIP-seq
MIRT935010 hsa-miR-3653 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0004090 Function Carbonyl reductase (NADPH) activity IDA 24246760, 26466768, 28457967, 28687384
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 24246760, 28457967
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612833 21524 ENSG00000100612
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y394
Protein name Dehydrogenase/reductase SDR family member 7 (EC 1.1.1.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1) (Protein SDR34C1)
Protein function NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including steroids, retinoids and xenobiotics (PubMed:24246760, PubMed:26466768, PubMed:28457967, PubMed:28687384). Catalyzes the redu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 51 250 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Found predominantly in the adrenal glands, liver, thyroid, prostate, small intestine, colon, stomach, kidney and brain (PubMed:26466768). Lower levels observed in skeletal muscle, the lung and the spleen (PubMed:26466768). {ECO:0000269
Sequence
MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASS
GIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEA
ATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIER
KQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSN
IVENSLAGEV
TKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQY
MPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD
Sequence length 339
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Gastric cancer Uncertain significance rs751714239 RCV005929250
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Neoplasms Inhibit 26311046
Prostatic Neoplasms Associate 26311046, 38201261
Prostatitis Associate 38201261
Stomach Neoplasms Associate 34773716