Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51635
Gene name Gene Name - the full gene name approved by the HGNC.
Dehydrogenase/reductase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DHRS7
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-86, SDR34C1, retDSR4, retSDR4
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT935006 hsa-miR-1470 CLIP-seq
MIRT935007 hsa-miR-1825 CLIP-seq
MIRT935008 hsa-miR-199a-5p CLIP-seq
MIRT935009 hsa-miR-199b-5p CLIP-seq
MIRT935010 hsa-miR-3653 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004090 Function Carbonyl reductase (NADPH) activity IDA 24246760, 26466768, 28457967, 28687384
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 24246760, 28457967
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612833 21524 ENSG00000100612
Protein
UniProt ID Q9Y394
Protein name Dehydrogenase/reductase SDR family member 7 (EC 1.1.1.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1) (Protein SDR34C1)
Protein function NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including steroids, retinoids and xenobiotics (PubMed:24246760, PubMed:26466768, PubMed:28457967, PubMed:28687384). Catalyzes the redu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 51 250 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Found predominantly in the adrenal glands, liver, thyroid, prostate, small intestine, colon, stomach, kidney and brain (PubMed:26466768). Lower levels observed in skeletal muscle, the lung and the spleen (PubMed:26466768). {ECO:0000269
Sequence
MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASS
GIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEA
ATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIER
KQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSN
IVENSLAGEV
TKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQY
MPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD
Sequence length 339
Interactions View interactions
<