Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51633
Gene name Gene Name - the full gene name approved by the HGNC.	OTU deubiquitinase 6B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OTUD6B
Synonyms (NCBI Gene) Gene synonyms aliases	CGI-77, DUBA-5, DUBA5, IDDFSDA
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a neg

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs150848976	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs368313959	C>T	Pathogenic	Stop gained, coding sequence variant
rs747009288	G>A,C	Pathogenic	Splice donor variant
rs759317757	TTAAC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064797103	A>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant

Show/Hide all(174)

miRTarBase ID	miRNA	Experiments
MIRT1208011	hsa-miR-1179	CLIP-seq
MIRT1208012	hsa-miR-1283	CLIP-seq
MIRT1208013	hsa-miR-196a	CLIP-seq
MIRT1208014	hsa-miR-196b	CLIP-seq
MIRT1208015	hsa-miR-199a-3p	CLIP-seq
MIRT1208016	hsa-miR-199b-3p	CLIP-seq
MIRT1208017	hsa-miR-3065-3p	CLIP-seq
MIRT1208018	hsa-miR-3125	CLIP-seq
MIRT1208019	hsa-miR-3129-5p	CLIP-seq
MIRT1208020	hsa-miR-3529	CLIP-seq
MIRT1208021	hsa-miR-3614-5p	CLIP-seq
MIRT1208022	hsa-miR-379	CLIP-seq
MIRT1208023	hsa-miR-3916	CLIP-seq
MIRT1208024	hsa-miR-4277	CLIP-seq
MIRT1208025	hsa-miR-4291	CLIP-seq
MIRT1208026	hsa-miR-4451	CLIP-seq
MIRT1208027	hsa-miR-4499	CLIP-seq
MIRT1208028	hsa-miR-4513	CLIP-seq
MIRT1208029	hsa-miR-4645-3p	CLIP-seq
MIRT1208030	hsa-miR-4650-3p	CLIP-seq
MIRT1208031	hsa-miR-4703-3p	CLIP-seq
MIRT1208032	hsa-miR-4742-3p	CLIP-seq
MIRT1208033	hsa-miR-4773	CLIP-seq
MIRT1208034	hsa-miR-4799-5p	CLIP-seq
MIRT1208035	hsa-miR-495	CLIP-seq
MIRT1208036	hsa-miR-510	CLIP-seq
MIRT1208037	hsa-miR-512-5p	CLIP-seq
MIRT1208038	hsa-miR-548ag	CLIP-seq
MIRT1208039	hsa-miR-548ai	CLIP-seq
MIRT1208040	hsa-miR-548u	CLIP-seq
MIRT1208041	hsa-miR-561	CLIP-seq
MIRT1208042	hsa-miR-583	CLIP-seq
MIRT1208043	hsa-miR-936	CLIP-seq
MIRT2059766	hsa-miR-1207-5p	CLIP-seq
MIRT2059767	hsa-miR-1271	CLIP-seq
MIRT2059768	hsa-miR-1298	CLIP-seq
MIRT2059769	hsa-miR-135a	CLIP-seq
MIRT2059770	hsa-miR-135b	CLIP-seq
MIRT2059771	hsa-miR-182	CLIP-seq
MIRT2059772	hsa-miR-2054	CLIP-seq
MIRT2059773	hsa-miR-23a	CLIP-seq
MIRT2059774	hsa-miR-23b	CLIP-seq
MIRT2059775	hsa-miR-23c	CLIP-seq
MIRT2059776	hsa-miR-3163	CLIP-seq
MIRT2059777	hsa-miR-340	CLIP-seq
MIRT2059778	hsa-miR-3613-3p	CLIP-seq
MIRT2059779	hsa-miR-3613-5p	CLIP-seq
MIRT2059780	hsa-miR-4282	CLIP-seq
MIRT2059781	hsa-miR-4514	CLIP-seq
MIRT2059782	hsa-miR-4692	CLIP-seq
MIRT2059783	hsa-miR-4699-3p	CLIP-seq
MIRT1208031	hsa-miR-4703-3p	CLIP-seq
MIRT2059784	hsa-miR-4736	CLIP-seq
MIRT2059785	hsa-miR-4763-3p	CLIP-seq
MIRT2059786	hsa-miR-490-5p	CLIP-seq
MIRT1208035	hsa-miR-495	CLIP-seq
MIRT2059787	hsa-miR-516a-3p	CLIP-seq
MIRT2059788	hsa-miR-520d-5p	CLIP-seq
MIRT2059789	hsa-miR-524-5p	CLIP-seq
MIRT2059790	hsa-miR-548c-3p	CLIP-seq
MIRT2059791	hsa-miR-548p	CLIP-seq
MIRT1208040	hsa-miR-548u	CLIP-seq
MIRT2059792	hsa-miR-579	CLIP-seq
MIRT2059793	hsa-miR-96	CLIP-seq
MIRT2288115	hsa-miR-1251	CLIP-seq
MIRT2288116	hsa-miR-1252	CLIP-seq
MIRT2288117	hsa-miR-1323	CLIP-seq
MIRT2288118	hsa-miR-217	CLIP-seq
MIRT2288119	hsa-miR-219-1-3p	CLIP-seq
MIRT2288120	hsa-miR-3122	CLIP-seq
MIRT2288121	hsa-miR-3153	CLIP-seq
MIRT2288122	hsa-miR-3660	CLIP-seq
MIRT2288123	hsa-miR-3913-5p	CLIP-seq
MIRT2288124	hsa-miR-409-5p	CLIP-seq
MIRT2288125	hsa-miR-4261	CLIP-seq
MIRT2288126	hsa-miR-4418	CLIP-seq
MIRT2288127	hsa-miR-4420	CLIP-seq
MIRT2288128	hsa-miR-4470	CLIP-seq
MIRT2288129	hsa-miR-4526	CLIP-seq
MIRT2288130	hsa-miR-4668-5p	CLIP-seq
MIRT2288131	hsa-miR-4698	CLIP-seq
MIRT2288132	hsa-miR-499-3p	CLIP-seq
MIRT2288133	hsa-miR-499a-3p	CLIP-seq
MIRT2288134	hsa-miR-509-3-5p	CLIP-seq
MIRT2288135	hsa-miR-509-5p	CLIP-seq
MIRT2288136	hsa-miR-548o	CLIP-seq
MIRT2059791	hsa-miR-548p	CLIP-seq
MIRT2288137	hsa-miR-568	CLIP-seq
MIRT2288138	hsa-miR-571	CLIP-seq
MIRT2059792	hsa-miR-579	CLIP-seq
MIRT1208011	hsa-miR-1179	CLIP-seq
MIRT1208013	hsa-miR-196a	CLIP-seq
MIRT1208014	hsa-miR-196b	CLIP-seq
MIRT1208015	hsa-miR-199a-3p	CLIP-seq
MIRT1208016	hsa-miR-199b-3p	CLIP-seq
MIRT1208019	hsa-miR-3129-5p	CLIP-seq
MIRT2059776	hsa-miR-3163	CLIP-seq
MIRT2059777	hsa-miR-340	CLIP-seq
MIRT2059779	hsa-miR-3613-5p	CLIP-seq
MIRT2586292	hsa-miR-3925-3p	CLIP-seq
MIRT2586293	hsa-miR-4263	CLIP-seq
MIRT2586294	hsa-miR-4659a-5p	CLIP-seq
MIRT2586295	hsa-miR-4659b-5p	CLIP-seq
MIRT2059783	hsa-miR-4699-3p	CLIP-seq
MIRT1208031	hsa-miR-4703-3p	CLIP-seq
MIRT2586296	hsa-miR-4720-3p	CLIP-seq
MIRT2586297	hsa-miR-4764-3p	CLIP-seq
MIRT2586298	hsa-miR-4776-3p	CLIP-seq
MIRT1208034	hsa-miR-4799-5p	CLIP-seq
MIRT2586299	hsa-miR-4804-3p	CLIP-seq
MIRT2059786	hsa-miR-490-5p	CLIP-seq
MIRT2586300	hsa-miR-508-5p	CLIP-seq
MIRT2586301	hsa-miR-548a-3p	CLIP-seq
MIRT2586302	hsa-miR-548ac	CLIP-seq
MIRT2586303	hsa-miR-548ae	CLIP-seq
MIRT1208038	hsa-miR-548ag	CLIP-seq
MIRT1208039	hsa-miR-548ai	CLIP-seq
MIRT2586304	hsa-miR-548aj	CLIP-seq
MIRT2586305	hsa-miR-548am	CLIP-seq
MIRT2059790	hsa-miR-548c-3p	CLIP-seq
MIRT2586306	hsa-miR-548d-3p	CLIP-seq
MIRT2586307	hsa-miR-548e	CLIP-seq
MIRT2586308	hsa-miR-548f	CLIP-seq
MIRT2059791	hsa-miR-548p	CLIP-seq
MIRT2586309	hsa-miR-548x	CLIP-seq
MIRT2586310	hsa-miR-548z	CLIP-seq
MIRT2586311	hsa-miR-576-5p	CLIP-seq
MIRT1208043	hsa-miR-936	CLIP-seq
MIRT1208011	hsa-miR-1179	CLIP-seq
MIRT1208013	hsa-miR-196a	CLIP-seq
MIRT1208014	hsa-miR-196b	CLIP-seq
MIRT1208015	hsa-miR-199a-3p	CLIP-seq
MIRT1208016	hsa-miR-199b-3p	CLIP-seq
MIRT1208017	hsa-miR-3065-3p	CLIP-seq
MIRT1208019	hsa-miR-3129-5p	CLIP-seq
MIRT2059776	hsa-miR-3163	CLIP-seq
MIRT2059777	hsa-miR-340	CLIP-seq
MIRT1208020	hsa-miR-3529	CLIP-seq
MIRT1208021	hsa-miR-3614-5p	CLIP-seq
MIRT1208022	hsa-miR-379	CLIP-seq
MIRT2586292	hsa-miR-3925-3p	CLIP-seq
MIRT2586293	hsa-miR-4263	CLIP-seq
MIRT1208024	hsa-miR-4277	CLIP-seq
MIRT1208025	hsa-miR-4291	CLIP-seq
MIRT1208026	hsa-miR-4451	CLIP-seq
MIRT1208030	hsa-miR-4650-3p	CLIP-seq
MIRT2586294	hsa-miR-4659a-5p	CLIP-seq
MIRT2586295	hsa-miR-4659b-5p	CLIP-seq
MIRT2059783	hsa-miR-4699-3p	CLIP-seq
MIRT1208031	hsa-miR-4703-3p	CLIP-seq
MIRT2586296	hsa-miR-4720-3p	CLIP-seq
MIRT2586297	hsa-miR-4764-3p	CLIP-seq
MIRT1208033	hsa-miR-4773	CLIP-seq
MIRT2586298	hsa-miR-4776-3p	CLIP-seq
MIRT1208034	hsa-miR-4799-5p	CLIP-seq
MIRT2586299	hsa-miR-4804-3p	CLIP-seq
MIRT2586300	hsa-miR-508-5p	CLIP-seq
MIRT1208036	hsa-miR-510	CLIP-seq
MIRT1208037	hsa-miR-512-5p	CLIP-seq
MIRT2586301	hsa-miR-548a-3p	CLIP-seq
MIRT2586302	hsa-miR-548ac	CLIP-seq
MIRT2586303	hsa-miR-548ae	CLIP-seq
MIRT1208038	hsa-miR-548ag	CLIP-seq
MIRT1208039	hsa-miR-548ai	CLIP-seq
MIRT2586304	hsa-miR-548aj	CLIP-seq
MIRT2586305	hsa-miR-548am	CLIP-seq
MIRT2059790	hsa-miR-548c-3p	CLIP-seq
MIRT2586306	hsa-miR-548d-3p	CLIP-seq
MIRT2586307	hsa-miR-548e	CLIP-seq
MIRT2586308	hsa-miR-548f	CLIP-seq
MIRT2586309	hsa-miR-548x	CLIP-seq
MIRT2586310	hsa-miR-548z	CLIP-seq
MIRT2586311	hsa-miR-576-5p	CLIP-seq
MIRT1208043	hsa-miR-936	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	21267069
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33421002, 33961781
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008283	Process	Cell population proliferation	IDA	27864334
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IDA	27864334
GO:0016579	Process	Protein deubiquitination	IDA	21267069
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	IMP	27864334
GO:0016787	Function	Hydrolase activity	IEA
GO:0017148	Process	Negative regulation of translation	IMP	27864334
GO:0043248	Process	Proteasome assembly	IMP	28343629
GO:0045727	Process	Positive regulation of translation	IMP	27864334

MIM	HGNC	e!Ensembl
612021	24281	ENSG00000155100

Protein

UniProt ID

Q8N6M0

Protein name

Deubiquitinase OTUD6B (EC 3.4.19.12) (DUBA-5) (OTU domain-containing protein 6B)

Protein function

[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 (PubMed:21267069, PubMed:27864334). May associate with the protein synthesis initiation complex and modify

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02338	OTU	153 → 278	OTU-like cysteine protease	Family

Sequence

MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEME
QKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIA
EAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALR
SQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQT
PIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS

Sequence length

293

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Intellectual Developmental Disorder With Dysmorphic Facies, Seizures, And Distal Limb Anomalies	intellectual developmental disorder with dysmorphic facies, seizures, and distal limb anomalies	rs150848976, rs368313959, rs759317757, rs1064797102, rs1064797103	N/A

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aging Premature	Associate	37110517
Alcohol Related Disorders	Associate	34680978
Breast Neoplasms	Associate	33225954, 35441740, 37110517
Carcinogenesis	Associate	32952848
Carcinoma Non Small Cell Lung	Associate	27864334
Carcinoma Renal Cell	Inhibit	32256450
Carcinoma Renal Cell	Associate	35110537
Cell Transformation Neoplastic	Associate	36052059
Congenital Abnormalities	Associate	32924626
Drug Related Side Effects and Adverse Reactions	Associate	32952848
Edema	Associate	34680978
Epilepsy	Associate	34680978
Esophageal Squamous Cell Carcinoma	Inhibit	37038094
Facial Dysmorphism with Multiple Malformations	Associate	34680978
Fryns syndrome	Associate	34680978
Hypothyroidism	Associate	32924626
Intellectual Disability	Associate	32924626, 34680978, 35430327
Lung Neoplasms	Associate	36052059
Lymphatic Metastasis	Inhibit	32256450
Multiple Myeloma	Associate	36059274
Neoplasms	Inhibit	32256450
Neoplasms	Associate	34440306, 36059274
Neoplasms	Stimulate	36052059
Osteosarcoma	Associate	34440306
Pulmonary Disease Chronic Obstructive	Stimulate	36052059
Scleroderma Systemic	Associate	29179949
Scleroderma Systemic	Inhibit	31156645
Seizures	Associate	32924626
Thyroid Neoplasms	Inhibit	32256450
Urinary Bladder Neoplasms	Associate	32952848
von Hippel Lindau Disease	Associate	35110537
Williams Syndrome	Associate	34680978

OTUD6B (OTU deubiquitinase 6B)