Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51633
Gene name Gene Name - the full gene name approved by the HGNC.
OTU deubiquitinase 6B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OTUD6B
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-77, DUBA-5, DUBA5, IDDFSDA
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a neg
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs150848976 T>C Likely-pathogenic Coding sequence variant, missense variant
rs368313959 C>T Pathogenic Stop gained, coding sequence variant
rs747009288 G>A,C Pathogenic Splice donor variant
rs759317757 TTAAC>- Pathogenic Frameshift variant, coding sequence variant
rs1064797103 A>G Likely-pathogenic, pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1208011 hsa-miR-1179 CLIP-seq
MIRT1208012 hsa-miR-1283 CLIP-seq
MIRT1208013 hsa-miR-196a CLIP-seq
MIRT1208014 hsa-miR-196b CLIP-seq
MIRT1208015 hsa-miR-199a-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004843 Function Cysteine-type deubiquitinase activity IBA
GO:0004843 Function Cysteine-type deubiquitinase activity IDA 21267069
GO:0004843 Function Cysteine-type deubiquitinase activity IEA
GO:0005515 Function Protein binding IPI 28514442, 33421002, 33961781
GO:0006508 Process Proteolysis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612021 24281 ENSG00000155100
Protein
UniProt ID Q8N6M0
Protein name Deubiquitinase OTUD6B (EC 3.4.19.12) (DUBA-5) (OTU domain-containing protein 6B)
Protein function [Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 (PubMed:21267069, PubMed:27864334). May associate with the protein synthesis initiation complex and modify
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02338 OTU 153 278 OTU-like cysteine protease Family
Sequence
MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEME
QKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIA
EAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALR
SQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQT
PIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHY
NSVTRLVNIVTENCS
Sequence length 293
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Intellectual Developmental Disorder With Dysmorphic Facies, Seizures, And Distal Limb Anomalies intellectual developmental disorder with dysmorphic facies, seizures, and distal limb anomalies rs368313959, rs759317757, rs1064797102, rs1064797103, rs150848976 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aging Premature Associate 37110517
Alcohol Related Disorders Associate 34680978
Breast Neoplasms Associate 33225954, 35441740, 37110517
Carcinogenesis Associate 32952848
Carcinoma Non Small Cell Lung Associate 27864334
Carcinoma Renal Cell Inhibit 32256450
Carcinoma Renal Cell Associate 35110537
Cell Transformation Neoplastic Associate 36052059
Congenital Abnormalities Associate 32924626
Drug Related Side Effects and Adverse Reactions Associate 32952848