Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5163
Gene name	Pyruvate dehydrogenase kinase 1
Gene symbol	PDK1
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q31.1
Summary	Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic acti

340

Show/Hide all (340)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000055	hsa-miR-375	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21533613
MIRT000055	hsa-miR-375	Western blot	20215506
MIRT020770	hsa-miR-155-5p	Proteomics	18668040
MIRT029318	hsa-miR-26b-5p	Microarray	19088304
MIRT032356	hsa-let-7b-5p	Proteomics	18668040
MIRT000055	hsa-miR-375	Luciferase reporter assayWestern blot	24137444
MIRT437911	hsa-miR-105-5p	Luciferase reporter assayWestern blot	25280563
MIRT000055	hsa-miR-375	Luciferase reporter assay	24481267
MIRT000055	hsa-miR-375	Luciferase reporter assay	24481267
MIRT000055	hsa-miR-375	Luciferase reporter assay	24481267
MIRT000055	hsa-miR-375	Luciferase reporter assay	24481267
MIRT020770	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020770	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT156318	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT156323	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT156324	hsa-miR-128-3p	Luciferase reporter assayqRT-PCRWestern blot	26949090
MIRT156324	hsa-miR-128-3p	Luciferase reporter assayqRT-PCRWestern blot	26949090
MIRT156324	hsa-miR-128-3p	Luciferase reporter assayqRT-PCRWestern blot	26949090
MIRT732675	hsa-miR-330-5p	Luciferase reporter assayqRT-PCR	33061606
MIRT732844	hsa-miR-877-5p	Luciferase reporter assayqRT-PCRWestern blotting	34078519
MIRT733115	hsa-miR-503-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	31802909
MIRT734719	hsa-miR-214-3p	Western blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32051833
MIRT000055	hsa-miR-375	Microarray	31603566
MIRT156324	hsa-miR-128-3p	Microarray	31603566
MIRT1221680	hsa-miR-125a-3p	CLIP-seq
MIRT1221681	hsa-miR-1285	CLIP-seq
MIRT1221682	hsa-miR-129-5p	CLIP-seq
MIRT1221683	hsa-miR-2278	CLIP-seq
MIRT1221684	hsa-miR-3123	CLIP-seq
MIRT1221685	hsa-miR-3155	CLIP-seq
MIRT1221686	hsa-miR-3155b	CLIP-seq
MIRT1221687	hsa-miR-3160-5p	CLIP-seq
MIRT1221688	hsa-miR-3168	CLIP-seq
MIRT1221689	hsa-miR-3187-5p	CLIP-seq
MIRT1221690	hsa-miR-3194-3p	CLIP-seq
MIRT1221691	hsa-miR-3194-5p	CLIP-seq
MIRT1221692	hsa-miR-326	CLIP-seq
MIRT1221693	hsa-miR-3617	CLIP-seq
MIRT1221694	hsa-miR-369-3p	CLIP-seq
MIRT1221695	hsa-miR-374a	CLIP-seq
MIRT1221696	hsa-miR-374b	CLIP-seq
MIRT1221697	hsa-miR-378g	CLIP-seq
MIRT1221698	hsa-miR-3913-3p	CLIP-seq
MIRT737802	hsa-miR-3934	CLIP-seq
MIRT1221699	hsa-miR-4303	CLIP-seq
MIRT1221700	hsa-miR-4311	CLIP-seq
MIRT737798	hsa-miR-4328	CLIP-seq
MIRT1221701	hsa-miR-4468	CLIP-seq
MIRT1221702	hsa-miR-4486	CLIP-seq
MIRT1221703	hsa-miR-4503	CLIP-seq
MIRT1221704	hsa-miR-4539	CLIP-seq
MIRT1221705	hsa-miR-4640-5p	CLIP-seq
MIRT737801	hsa-miR-4648	CLIP-seq
MIRT737799	hsa-miR-4654	CLIP-seq
MIRT1221706	hsa-miR-4659a-3p	CLIP-seq
MIRT1221707	hsa-miR-4659b-3p	CLIP-seq
MIRT1221708	hsa-miR-4676-5p	CLIP-seq
MIRT1221709	hsa-miR-4684-5p	CLIP-seq
MIRT1221710	hsa-miR-4698	CLIP-seq
MIRT1221711	hsa-miR-4726-5p	CLIP-seq
MIRT737803	hsa-miR-4733-3p	CLIP-seq
MIRT1221712	hsa-miR-4765	CLIP-seq
MIRT737800	hsa-miR-4769-5p	CLIP-seq
MIRT1221713	hsa-miR-4797-5p	CLIP-seq
MIRT1221714	hsa-miR-484	CLIP-seq
MIRT1221715	hsa-miR-520d-5p	CLIP-seq
MIRT1221716	hsa-miR-524-5p	CLIP-seq
MIRT1221717	hsa-miR-539	CLIP-seq
MIRT1221718	hsa-miR-548a-5p	CLIP-seq
MIRT1221719	hsa-miR-548ab	CLIP-seq
MIRT1221720	hsa-miR-548ak	CLIP-seq
MIRT1221721	hsa-miR-548b-5p	CLIP-seq
MIRT1221722	hsa-miR-548c-5p	CLIP-seq
MIRT1221723	hsa-miR-548d-5p	CLIP-seq
MIRT1221724	hsa-miR-548h	CLIP-seq
MIRT1221725	hsa-miR-548i	CLIP-seq
MIRT1221726	hsa-miR-548j	CLIP-seq
MIRT1221727	hsa-miR-548k	CLIP-seq
MIRT1221728	hsa-miR-548l	CLIP-seq
MIRT1221729	hsa-miR-548w	CLIP-seq
MIRT1221730	hsa-miR-548y	CLIP-seq
MIRT1221731	hsa-miR-559	CLIP-seq
MIRT1221732	hsa-miR-575	CLIP-seq
MIRT1221733	hsa-miR-606	CLIP-seq
MIRT1221734	hsa-miR-612	CLIP-seq
MIRT1221735	hsa-miR-641	CLIP-seq
MIRT1221736	hsa-miR-760	CLIP-seq
MIRT1221737	hsa-miR-764	CLIP-seq
MIRT1221738	hsa-miR-767-3p	CLIP-seq
MIRT737797	hsa-miR-767-5p	CLIP-seq
MIRT1221739	hsa-miR-890	CLIP-seq
MIRT1221740	hsa-miR-942	CLIP-seq
MIRT2063965	hsa-miR-25	CLIP-seq
MIRT2063966	hsa-miR-302f	CLIP-seq
MIRT2063967	hsa-miR-3167	CLIP-seq
MIRT2063968	hsa-miR-32	CLIP-seq
MIRT2063969	hsa-miR-3609	CLIP-seq
MIRT2063970	hsa-miR-363	CLIP-seq
MIRT2063971	hsa-miR-3664-3p	CLIP-seq
MIRT2063972	hsa-miR-367	CLIP-seq
MIRT2063973	hsa-miR-3670	CLIP-seq
MIRT2063974	hsa-miR-3671	CLIP-seq
MIRT2063975	hsa-miR-3919	CLIP-seq
MIRT737802	hsa-miR-3934	CLIP-seq
MIRT2063976	hsa-miR-3942-3p	CLIP-seq
MIRT2063977	hsa-miR-421	CLIP-seq
MIRT737798	hsa-miR-4328	CLIP-seq
MIRT2063978	hsa-miR-4433	CLIP-seq
MIRT2063979	hsa-miR-4459	CLIP-seq
MIRT2063980	hsa-miR-4643	CLIP-seq
MIRT737801	hsa-miR-4648	CLIP-seq
MIRT737799	hsa-miR-4654	CLIP-seq
MIRT2063981	hsa-miR-466	CLIP-seq
MIRT2063982	hsa-miR-4722-5p	CLIP-seq
MIRT2063983	hsa-miR-4729	CLIP-seq
MIRT737803	hsa-miR-4733-3p	CLIP-seq
MIRT2063984	hsa-miR-4735-5p	CLIP-seq
MIRT2063985	hsa-miR-4756-3p	CLIP-seq
MIRT2063986	hsa-miR-4768-3p	CLIP-seq
MIRT737800	hsa-miR-4769-5p	CLIP-seq
MIRT2063987	hsa-miR-4789-3p	CLIP-seq
MIRT2063988	hsa-miR-526b	CLIP-seq
MIRT2063989	hsa-miR-548ah	CLIP-seq
MIRT2063990	hsa-miR-576-5p	CLIP-seq
MIRT2063991	hsa-miR-578	CLIP-seq
MIRT2063992	hsa-miR-587	CLIP-seq
MIRT737797	hsa-miR-767-5p	CLIP-seq
MIRT2063993	hsa-miR-876-5p	CLIP-seq
MIRT2063994	hsa-miR-92a	CLIP-seq
MIRT2063995	hsa-miR-92b	CLIP-seq
MIRT2063996	hsa-miR-944	CLIP-seq
MIRT1221681	hsa-miR-1285	CLIP-seq
MIRT2292473	hsa-miR-130a	CLIP-seq
MIRT2292474	hsa-miR-130b	CLIP-seq
MIRT2292475	hsa-miR-1343	CLIP-seq
MIRT2292476	hsa-miR-138	CLIP-seq
MIRT2292477	hsa-miR-155	CLIP-seq
MIRT2292478	hsa-miR-205	CLIP-seq
MIRT2292479	hsa-miR-301a	CLIP-seq
MIRT2292480	hsa-miR-301b	CLIP-seq
MIRT2292481	hsa-miR-3138	CLIP-seq
MIRT2292482	hsa-miR-3145-5p	CLIP-seq
MIRT2292483	hsa-miR-3152-3p	CLIP-seq
MIRT2292484	hsa-miR-3165	CLIP-seq
MIRT2063967	hsa-miR-3167	CLIP-seq
MIRT1221689	hsa-miR-3187-5p	CLIP-seq
MIRT1221691	hsa-miR-3194-5p	CLIP-seq
MIRT2292485	hsa-miR-323-3p	CLIP-seq
MIRT2063971	hsa-miR-3664-3p	CLIP-seq
MIRT2292486	hsa-miR-3666	CLIP-seq
MIRT2063973	hsa-miR-3670	CLIP-seq
MIRT2063977	hsa-miR-421	CLIP-seq
MIRT2292487	hsa-miR-4252	CLIP-seq
MIRT2292488	hsa-miR-4295	CLIP-seq
MIRT737798	hsa-miR-4328	CLIP-seq
MIRT2292489	hsa-miR-4421	CLIP-seq
MIRT2063978	hsa-miR-4433	CLIP-seq
MIRT2292490	hsa-miR-4456	CLIP-seq
MIRT2063979	hsa-miR-4459	CLIP-seq
MIRT2292491	hsa-miR-454	CLIP-seq
MIRT2063982	hsa-miR-4722-5p	CLIP-seq
MIRT2063983	hsa-miR-4729	CLIP-seq
MIRT2063986	hsa-miR-4768-3p	CLIP-seq
MIRT2292492	hsa-miR-4793-5p	CLIP-seq
MIRT2292493	hsa-miR-508-5p	CLIP-seq
MIRT2063988	hsa-miR-526b	CLIP-seq
MIRT1221727	hsa-miR-548k	CLIP-seq
MIRT2063991	hsa-miR-578	CLIP-seq
MIRT1221734	hsa-miR-612	CLIP-seq
MIRT2063993	hsa-miR-876-5p	CLIP-seq
MIRT2292494	hsa-miR-892a	CLIP-seq
MIRT2063967	hsa-miR-3167	CLIP-seq
MIRT2063993	hsa-miR-876-5p	CLIP-seq
MIRT2063975	hsa-miR-3919	CLIP-seq
MIRT2063976	hsa-miR-3942-3p	CLIP-seq
MIRT2063985	hsa-miR-4756-3p	CLIP-seq
MIRT2590549	hsa-miR-10a	CLIP-seq
MIRT2590550	hsa-miR-10b	CLIP-seq
MIRT2590551	hsa-miR-1184	CLIP-seq
MIRT2590552	hsa-miR-1202	CLIP-seq
MIRT2590553	hsa-miR-1205	CLIP-seq
MIRT2590554	hsa-miR-1266	CLIP-seq
MIRT2590555	hsa-miR-1276	CLIP-seq
MIRT1221681	hsa-miR-1285	CLIP-seq
MIRT2590556	hsa-miR-133a	CLIP-seq
MIRT2590557	hsa-miR-133b	CLIP-seq
MIRT2292475	hsa-miR-1343	CLIP-seq
MIRT2590558	hsa-miR-150	CLIP-seq
MIRT2590559	hsa-miR-1976	CLIP-seq
MIRT2590560	hsa-miR-3074-3p	CLIP-seq
MIRT2292482	hsa-miR-3145-5p	CLIP-seq
MIRT2590561	hsa-miR-3148	CLIP-seq
MIRT1221685	hsa-miR-3155	CLIP-seq
MIRT1221686	hsa-miR-3155b	CLIP-seq
MIRT2590562	hsa-miR-3158-5p	CLIP-seq
MIRT1221689	hsa-miR-3187-5p	CLIP-seq
MIRT1221690	hsa-miR-3194-3p	CLIP-seq
MIRT1221691	hsa-miR-3194-5p	CLIP-seq
MIRT1221692	hsa-miR-326	CLIP-seq
MIRT2590563	hsa-miR-339-5p	CLIP-seq
MIRT2063971	hsa-miR-3664-3p	CLIP-seq
MIRT2590564	hsa-miR-3690	CLIP-seq
MIRT1221694	hsa-miR-369-3p	CLIP-seq
MIRT1221695	hsa-miR-374a	CLIP-seq
MIRT1221696	hsa-miR-374b	CLIP-seq
MIRT2590565	hsa-miR-378	CLIP-seq
MIRT2590566	hsa-miR-378b	CLIP-seq
MIRT2590567	hsa-miR-378c	CLIP-seq
MIRT2590568	hsa-miR-378d	CLIP-seq
MIRT2590569	hsa-miR-378e	CLIP-seq
MIRT2590570	hsa-miR-378f	CLIP-seq
MIRT1221697	hsa-miR-378g	CLIP-seq
MIRT2590571	hsa-miR-378h	CLIP-seq
MIRT2590572	hsa-miR-378i	CLIP-seq
MIRT2590573	hsa-miR-3972	CLIP-seq
MIRT2590574	hsa-miR-3973	CLIP-seq
MIRT2590575	hsa-miR-422a	CLIP-seq
MIRT2292487	hsa-miR-4252	CLIP-seq
MIRT2590576	hsa-miR-4254	CLIP-seq
MIRT1221699	hsa-miR-4303	CLIP-seq
MIRT2590577	hsa-miR-431	CLIP-seq
MIRT2590578	hsa-miR-4315	CLIP-seq
MIRT2292489	hsa-miR-4421	CLIP-seq
MIRT2590579	hsa-miR-4446-5p	CLIP-seq
MIRT1221702	hsa-miR-4486	CLIP-seq
MIRT2590580	hsa-miR-4496	CLIP-seq
MIRT2590581	hsa-miR-4502	CLIP-seq
MIRT2590582	hsa-miR-4518	CLIP-seq
MIRT2590583	hsa-miR-4635	CLIP-seq
MIRT1221705	hsa-miR-4640-5p	CLIP-seq
MIRT2590584	hsa-miR-4660	CLIP-seq
MIRT2590585	hsa-miR-4713-5p	CLIP-seq
MIRT2590586	hsa-miR-4725-5p	CLIP-seq
MIRT1221711	hsa-miR-4726-5p	CLIP-seq
MIRT1221712	hsa-miR-4765	CLIP-seq
MIRT2590587	hsa-miR-4790-5p	CLIP-seq
MIRT2292492	hsa-miR-4793-5p	CLIP-seq
MIRT1221714	hsa-miR-484	CLIP-seq
MIRT2590588	hsa-miR-504	CLIP-seq
MIRT2292493	hsa-miR-508-5p	CLIP-seq
MIRT2590589	hsa-miR-520g	CLIP-seq
MIRT2590590	hsa-miR-520h	CLIP-seq
MIRT2590591	hsa-miR-532-3p	CLIP-seq
MIRT1221717	hsa-miR-539	CLIP-seq
MIRT1221718	hsa-miR-548a-5p	CLIP-seq
MIRT2590592	hsa-miR-548aa	CLIP-seq
MIRT1221719	hsa-miR-548ab	CLIP-seq
MIRT1221720	hsa-miR-548ak	CLIP-seq
MIRT1221721	hsa-miR-548b-5p	CLIP-seq
MIRT1221722	hsa-miR-548c-5p	CLIP-seq
MIRT1221723	hsa-miR-548d-5p	CLIP-seq
MIRT1221724	hsa-miR-548h	CLIP-seq
MIRT1221725	hsa-miR-548i	CLIP-seq
MIRT1221726	hsa-miR-548j	CLIP-seq
MIRT1221727	hsa-miR-548k	CLIP-seq
MIRT1221728	hsa-miR-548l	CLIP-seq
MIRT1221729	hsa-miR-548w	CLIP-seq
MIRT1221730	hsa-miR-548y	CLIP-seq
MIRT1221731	hsa-miR-559	CLIP-seq
MIRT2590593	hsa-miR-607	CLIP-seq
MIRT1221734	hsa-miR-612	CLIP-seq
MIRT2590594	hsa-miR-642b	CLIP-seq
MIRT2590595	hsa-miR-646	CLIP-seq
MIRT1221736	hsa-miR-760	CLIP-seq
MIRT1221738	hsa-miR-767-3p	CLIP-seq
MIRT2590549	hsa-miR-10a	CLIP-seq
MIRT2590550	hsa-miR-10b	CLIP-seq
MIRT2590551	hsa-miR-1184	CLIP-seq
MIRT2590552	hsa-miR-1202	CLIP-seq
MIRT2590553	hsa-miR-1205	CLIP-seq
MIRT2590554	hsa-miR-1266	CLIP-seq
MIRT2590555	hsa-miR-1276	CLIP-seq
MIRT1221681	hsa-miR-1285	CLIP-seq
MIRT2590556	hsa-miR-133a	CLIP-seq
MIRT2590557	hsa-miR-133b	CLIP-seq
MIRT2590559	hsa-miR-1976	CLIP-seq
MIRT2590560	hsa-miR-3074-3p	CLIP-seq
MIRT1221685	hsa-miR-3155	CLIP-seq
MIRT1221686	hsa-miR-3155b	CLIP-seq
MIRT2590562	hsa-miR-3158-5p	CLIP-seq
MIRT1221689	hsa-miR-3187-5p	CLIP-seq
MIRT1221690	hsa-miR-3194-3p	CLIP-seq
MIRT1221691	hsa-miR-3194-5p	CLIP-seq
MIRT1221692	hsa-miR-326	CLIP-seq
MIRT2590563	hsa-miR-339-5p	CLIP-seq
MIRT2063971	hsa-miR-3664-3p	CLIP-seq
MIRT2590564	hsa-miR-3690	CLIP-seq
MIRT1221694	hsa-miR-369-3p	CLIP-seq
MIRT1221695	hsa-miR-374a	CLIP-seq
MIRT1221696	hsa-miR-374b	CLIP-seq
MIRT2590565	hsa-miR-378	CLIP-seq
MIRT2590566	hsa-miR-378b	CLIP-seq
MIRT2590567	hsa-miR-378c	CLIP-seq
MIRT2590568	hsa-miR-378d	CLIP-seq
MIRT2590569	hsa-miR-378e	CLIP-seq
MIRT2590570	hsa-miR-378f	CLIP-seq
MIRT1221697	hsa-miR-378g	CLIP-seq
MIRT2590571	hsa-miR-378h	CLIP-seq
MIRT2590572	hsa-miR-378i	CLIP-seq
MIRT2590573	hsa-miR-3972	CLIP-seq
MIRT2590574	hsa-miR-3973	CLIP-seq
MIRT2590575	hsa-miR-422a	CLIP-seq
MIRT2590576	hsa-miR-4254	CLIP-seq
MIRT2590577	hsa-miR-431	CLIP-seq
MIRT2590578	hsa-miR-4315	CLIP-seq
MIRT2292489	hsa-miR-4421	CLIP-seq
MIRT2687488	hsa-miR-4427	CLIP-seq
MIRT2590579	hsa-miR-4446-5p	CLIP-seq
MIRT1221702	hsa-miR-4486	CLIP-seq
MIRT2590581	hsa-miR-4502	CLIP-seq
MIRT2590582	hsa-miR-4518	CLIP-seq
MIRT2590583	hsa-miR-4635	CLIP-seq
MIRT2590584	hsa-miR-4660	CLIP-seq
MIRT2687489	hsa-miR-4680-3p	CLIP-seq
MIRT2590586	hsa-miR-4725-5p	CLIP-seq
MIRT2590587	hsa-miR-4790-5p	CLIP-seq
MIRT1221714	hsa-miR-484	CLIP-seq
MIRT2590588	hsa-miR-504	CLIP-seq
MIRT2590589	hsa-miR-520g	CLIP-seq
MIRT2590590	hsa-miR-520h	CLIP-seq
MIRT1221718	hsa-miR-548a-5p	CLIP-seq
MIRT1221719	hsa-miR-548ab	CLIP-seq
MIRT1221720	hsa-miR-548ak	CLIP-seq
MIRT1221721	hsa-miR-548b-5p	CLIP-seq
MIRT1221722	hsa-miR-548c-5p	CLIP-seq
MIRT1221723	hsa-miR-548d-5p	CLIP-seq
MIRT1221724	hsa-miR-548h	CLIP-seq
MIRT1221725	hsa-miR-548i	CLIP-seq
MIRT1221726	hsa-miR-548j	CLIP-seq
MIRT1221727	hsa-miR-548k	CLIP-seq
MIRT1221728	hsa-miR-548l	CLIP-seq
MIRT1221729	hsa-miR-548w	CLIP-seq
MIRT1221730	hsa-miR-548y	CLIP-seq
MIRT1221731	hsa-miR-559	CLIP-seq
MIRT2590593	hsa-miR-607	CLIP-seq
MIRT1221734	hsa-miR-612	CLIP-seq
MIRT2590594	hsa-miR-642b	CLIP-seq
MIRT2590595	hsa-miR-646	CLIP-seq
MIRT1221736	hsa-miR-760	CLIP-seq
MIRT1221738	hsa-miR-767-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Unknown	19910471

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	17683942
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	7499431
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IBA
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IDA	7499431
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IEA
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IMP	22195962
GO:0005515	Function	Protein binding	IPI	7782287, 17110931, 26942675, 27505672, 29568061, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	7499431
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006006	Process	Glucose metabolic process	TAS	7499431
GO:0008283	Process	Cell population proliferation	IMP	18541534
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IMP	18541534
GO:0010510	Process	Regulation of pyruvate decarboxylation to acetyl-CoA	IBA
GO:0010510	Process	Regulation of pyruvate decarboxylation to acetyl-CoA	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IBA
GO:0010906	Process	Regulation of glucose metabolic process	IMP	18541534
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0045254	Component	Pyruvate dehydrogenase complex	IEA
GO:0097411	Process	Hypoxia-inducible factor-1alpha signaling pathway	IMP	21763680

MIM	HGNC	e!Ensembl
602524	8809	ENSG00000152256

Q15118

Protein name

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial (EC 2.7.11.2) (Pyruvate dehydrogenase kinase isoform 1) (PDH kinase 1)

Protein function

Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2 (PubMed:7499431, PubMed:18541534, PubMed:22195962, PubMed:26942675, PubMed

PDB

2Q8F , 2Q8G , 2Q8H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10436	BCDHK_Adom3	56 → 220	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase	Family
PF02518	HATPase_c	268 → 393	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas. {ECO:0000269|PubMed:7499431}.

Sequence

MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP
ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA

Sequence length

436

Interactions

View interactions

	KEGG		Reactome
	HIF-1 signaling pathway Central carbon metabolism in cancer		Regulation of pyruvate dehydrogenase (PDH) complex Signaling by Retinoic Acid

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (76)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Aggressive Periodontitis	Inhibit	19892919	★★★★★ ★☆☆☆☆ Found in Text Mining only
Altitude Sickness	Inhibit	18954447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	28831118	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	31234900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	37528722	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	15504738, 16288304, 23562764, 24739482	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	28505181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	25257795, 26684827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	23435205, 29967001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Associate	29967001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	29449645, 31298047, 32197467, 34333105, 35151320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	21387259, 24925061, 30988063, 34211631, 35095099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37147361	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Associate	32385243	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	38103512	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	21035469, 21999454, 34997428, 37816733	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	37291167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	25384981	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	22347420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	37612452	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	24796928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Associate	25957288	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Stimulate	32750756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	11102805, 34390075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Stimulate	28505181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	21419810, 25257795, 31828927, 35264067	★★★★★ ★☆☆☆☆ Found in Text Mining only
HAIR AN syndrome	Associate	32197467	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Stimulate	18542064	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	26684827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	18542064, 24850901, 26059435, 27231905, 29117193, 29426376, 31078780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	23840896, 23852087, 27432037, 33378978, 34522167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	23852087, 26059435, 28590414, 29117193, 37867353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	28505181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	23836663	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	21035469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	36685513	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	37147361	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Associate	30995105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	19464003	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	17255356, 24334295	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Biphenotypic Acute	Associate	25313141	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	17255356, 24334295, 39343915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Acute	Associate	24334295	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Associate	37253111	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24925061, 30988063, 34211631, 36825595	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	32750756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	33962616	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	21173233	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	29967001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	28339028, 28595656, 33913671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Stimulate	28505181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Associate	25258405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	31828927	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	23321518, 32228485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	26547584, 32280708, 35656815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	26547584, 29954422	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11102805, 18349831, 18541534, 18542064, 19573809, 21035469, 21387259, 22347420, 22454520, 23135628, 23840896, 25301052, 26547584, 26684827, 28454566 View all (10 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	15736311, 34980012, 37528722	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	25017515, 29117193	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann Pick Disease Type C	Associate	26547584	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Associate	19925894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	36685513, 37291167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	34950224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	18349831, 32385243, 35081867, 35309839, 37828220, 37867353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Intraductal Neoplasms	Associate	24132918	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	29157747, 29461595	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	21035469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	21999454	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Stimulate	28505181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Associate	29271995, 32323827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Stimulate	32750756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34768921, 35381781, 36169922, 36916400, 37762374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	23135628, 32321153, 37496999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	32750756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	23709653	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34980012	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDK1 (pyruvate dehydrogenase kinase 1)