Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51626
Gene name Gene Name - the full gene name approved by the HGNC.
Dynein cytoplasmic 2 light intermediate chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DYNC2LI1
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-60, D2LIC, LIC3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a component of the dynein-2 microtubule motor protein complex that plays a role in the retrograde transport of cargo in primary cilia via the intraflagellar transport system. This gene is ubiquitously expressed and its
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs146698690 C>G,T Likely-benign, likely-pathogenic Missense variant, coding sequence variant
rs201151187 G>A Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, intron variant, splice acceptor variant
rs201948500 C>G Pathogenic Coding sequence variant, missense variant
rs374356079 G>A Pathogenic Splice donor variant, genic downstream transcript variant
rs745930390 C>G,T Pathogenic Missense variant, genic downstream transcript variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029378 hsa-miR-26b-5p Microarray 19088304
MIRT707579 hsa-miR-4760-3p HITS-CLIP 21572407
MIRT159513 hsa-miR-144-3p HITS-CLIP 21572407
MIRT707578 hsa-miR-128-3p HITS-CLIP 21572407
MIRT707577 hsa-miR-216a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003774 Function Motor activity IEA
GO:0005515 Function Protein binding IPI 21252941, 29742051
GO:0005737 Component Cytoplasm IDA 26130459
GO:0005794 Component Golgi apparatus IEA
GO:0005813 Component Centrosome IDA 26130459
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617083 24595 ENSG00000138036
Protein
UniProt ID Q8TCX1
Protein name Cytoplasmic dynein 2 light intermediate chain 1 (Dynein 2 light intermediate chain)
Protein function Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 2 complex (dynein-2 complex), a motor protein complex that drives the movement of cargos along microtubules within cilia and flagella in concert with the intrafl
PDB 6RLB , 6SC2 , 8RGH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05783 DLIC 2 179 Dynein light intermediate chain (DLIC) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in bone, brain, kidney, and cartilage (PubMed:26077881, PubMed:26130459). Lower expression in heart, liver, lung, placenta and thymus (PubMed:26077881). {ECO:0000269|PubMed:26077881, ECO:0000269|PubMed:26130459}.
Sequence
MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKP
TLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKP
NDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPV
P
LVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFG
IDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK
SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIELDS
Sequence length 351
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Motor proteins
Vasopressin-regulated water reabsorption
Salmonella infection
  Intraflagellar transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Asphyxiating thoracic dystrophy Saldino-Noonan Syndrome, Asphyxiating Thoracic Dystrophy 1 rs137853115, rs137853025, rs1565310938, rs137853028, rs137853029, rs137853030, rs137853031, rs137853032, rs431905499, rs137853033, rs137853034, rs137853035, rs431905500, rs483352907, rs387906980
View all (112 more)
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Unknown
Disease term Disease name Evidence References Source
Hamartoma Hamartoma ClinVar
Jeune Syndrome Jeune syndrome GenCC
Ellis-Van Creveld Syndrome Ellis-van Creveld syndrome GenCC
Short-Rib Thoracic Dysplasia With Or Without Polydactyly short-rib thoracic dysplasia 15 with polydactyly GenCC
Associations from Text Mining
Disease Name Relationship Type References
Ciliopathies Associate 33030252
Infertility Associate 28643089
Short Rib Polydactyly Syndrome Associate 26077881, 33030252
Short rib polydactyly syndrome Beemer type Associate 26077881
Transposition of Great Vessels Associate 32078439