Gene Gene information from NCBI Gene database.
Entrez ID 51621
Gene name KLF transcription factor 13
Gene symbol KLF13
Synonyms (NCBI Gene)
BTEB3FKLF2NSLP1RFLAT-1RFLAT1
Chromosome 15
Chromosome location 15q13.3
Summary KLF13 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich seque
miRNA miRNA information provided by mirtarbase database.
708
miRTarBase ID miRNA Experiments Reference
MIRT003421 hsa-miR-125b-5p MicroarrayqRT-PCRWestern blot 19396866
MIRT005339 hsa-miR-125a-5p ELISALuciferase reporter assayqRT-PCRWestern blot 20589685
MIRT005339 hsa-miR-125a-5p ELISALuciferase reporter assayqRT-PCRWestern blot 20589685
MIRT005339 hsa-miR-125a-5p ELISALuciferase reporter assayqRT-PCRWestern blot 20589685
MIRT005339 hsa-miR-125a-5p ELISALuciferase reporter assayqRT-PCRWestern blot 20589685
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605328 13672 ENSG00000169926
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2Y9
Protein name Krueppel-like factor 13 (Basic transcription element-binding protein 3) (BTE-binding protein 3) (Novel Sp1-like zinc finger transcription factor 1) (RANTES factor of late activated T-lymphocytes 1) (RFLAT-1) (Transcription factor BTEB3) (Transcription fac
Protein function Transcription factor that activates expression from GC-rich minimal promoter regions, including genes in the cells of the erythroid lineage (By similarity). Represses transcription by binding to the BTE site, a GC-rich DNA element, in competitio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 167 191 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 197 221 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 227 249 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSAS
LFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSP
AWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK
SSHLKAHLRTH
TGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD
HLTKHARRH
ANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
Sequence length 288
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital heart disease Uncertain significance rs969811939 RCV001839337
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 39202416
Bone Diseases Metabolic Associate 25565391
Carcinogenesis Associate 37817224
Cardiomyopathy Dilated Associate 36346048
Chromosome 15q13.3 Microdeletion Syndrome Stimulate 19372089
Eosinophilic Esophagitis Associate 29029802
familial dilated cardiomyopathy Associate 36346048
Fibrosis Associate 37029927
Heart Defects Congenital Associate 32293321
Heart Diseases Associate 19372089