Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51621
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF13
Synonyms (NCBI Gene) Gene synonyms aliases
BTEB3, FKLF2, NSLP1, RFLAT-1, RFLAT1
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
KLF13 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich seque
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003421 hsa-miR-125b-5p Microarray, qRT-PCR, Western blot 19396866
MIRT005339 hsa-miR-125a-5p ELISA, Luciferase reporter assay, qRT-PCR, Western blot 20589685
MIRT005339 hsa-miR-125a-5p ELISA, Luciferase reporter assay, qRT-PCR, Western blot 20589685
MIRT005339 hsa-miR-125a-5p ELISA, Luciferase reporter assay, qRT-PCR, Western blot 20589685
MIRT005339 hsa-miR-125a-5p ELISA, Luciferase reporter assay, qRT-PCR, Western blot 20589685
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605328 13672 ENSG00000169926
Protein
UniProt ID Q9Y2Y9
Protein name Krueppel-like factor 13 (Basic transcription element-binding protein 3) (BTE-binding protein 3) (Novel Sp1-like zinc finger transcription factor 1) (RANTES factor of late activated T-lymphocytes 1) (RFLAT-1) (Transcription factor BTEB3) (Transcription fac
Protein function Transcription factor that activates expression from GC-rich minimal promoter regions, including genes in the cells of the erythroid lineage (By similarity). Represses transcription by binding to the BTE site, a GC-rich DNA element, in competitio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 167 191 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 197 221 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 227 249 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSAS
LFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSP
AWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK
SSHLKAHLRTH
TGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD
HLTKHARRH
ANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
Sequence length 288
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Survival in colorectal cancer (non-distant metastatic) N/A N/A GWAS
Congenital Heart Disease congenital heart disease N/A N/A GenCC
Diabetes Type 2 diabetes N/A N/A GWAS
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 39202416
Bone Diseases Metabolic Associate 25565391
Carcinogenesis Associate 37817224
Cardiomyopathy Dilated Associate 36346048
Chromosome 15q13.3 Microdeletion Syndrome Stimulate 19372089
Eosinophilic Esophagitis Associate 29029802
familial dilated cardiomyopathy Associate 36346048
Fibrosis Associate 37029927
Heart Defects Congenital Associate 32293321
Heart Diseases Associate 19372089