Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51611
Gene name Gene Name - the full gene name approved by the HGNC.	Diphthamide biosynthesis 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPH5
Synonyms (NCBI Gene) Gene synonyms aliases	AD-018, CGI-30, HSPC143, NEDSFF, NPD015
Disease Acronyms (UniProt) Disease acronyms from UniProt database	NEDSFF
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheri

Show/Hide all(93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022425	hsa-miR-124-3p	Microarray	18668037
MIRT052597	hsa-let-7a-5p	CLASH	23622248
MIRT039181	hsa-miR-769-5p	CLASH	23622248
MIRT944039	hsa-miR-3163	CLIP-seq
MIRT944040	hsa-miR-340	CLIP-seq
MIRT944041	hsa-miR-4695-3p	CLIP-seq
MIRT944042	hsa-miR-548aa	CLIP-seq
MIRT944043	hsa-miR-15a	CLIP-seq
MIRT944044	hsa-miR-15b	CLIP-seq
MIRT944045	hsa-miR-16	CLIP-seq
MIRT944046	hsa-miR-195	CLIP-seq
MIRT944047	hsa-miR-424	CLIP-seq
MIRT944048	hsa-miR-4524	CLIP-seq
MIRT944049	hsa-miR-497	CLIP-seq
MIRT944050	hsa-miR-503	CLIP-seq
MIRT944051	hsa-miR-646	CLIP-seq
MIRT2387090	hsa-miR-128	CLIP-seq
MIRT2387091	hsa-miR-27a	CLIP-seq
MIRT2387092	hsa-miR-27b	CLIP-seq
MIRT2387093	hsa-miR-3652	CLIP-seq
MIRT2387094	hsa-miR-3692	CLIP-seq
MIRT2387095	hsa-miR-4430	CLIP-seq
MIRT2387096	hsa-miR-4505	CLIP-seq
MIRT2387097	hsa-miR-4717-3p	CLIP-seq
MIRT2387090	hsa-miR-128	CLIP-seq
MIRT2448505	hsa-miR-140-3p	CLIP-seq
MIRT2387091	hsa-miR-27a	CLIP-seq
MIRT2387092	hsa-miR-27b	CLIP-seq
MIRT2387093	hsa-miR-3652	CLIP-seq
MIRT2387094	hsa-miR-3692	CLIP-seq
MIRT2448506	hsa-miR-4275	CLIP-seq
MIRT2448507	hsa-miR-4313	CLIP-seq
MIRT2387095	hsa-miR-4430	CLIP-seq
MIRT2448508	hsa-miR-4493	CLIP-seq
MIRT2387096	hsa-miR-4505	CLIP-seq
MIRT2448509	hsa-miR-4646-5p	CLIP-seq
MIRT2387097	hsa-miR-4717-3p	CLIP-seq
MIRT2448510	hsa-miR-4747-5p	CLIP-seq
MIRT2387090	hsa-miR-128	CLIP-seq
MIRT2519040	hsa-miR-133a	CLIP-seq
MIRT2519041	hsa-miR-133b	CLIP-seq
MIRT2387091	hsa-miR-27a	CLIP-seq
MIRT2387092	hsa-miR-27b	CLIP-seq
MIRT2519042	hsa-miR-3064-3p	CLIP-seq
MIRT2519043	hsa-miR-3180-5p	CLIP-seq
MIRT2519044	hsa-miR-3185	CLIP-seq
MIRT2519045	hsa-miR-3614-5p	CLIP-seq
MIRT2387093	hsa-miR-3652	CLIP-seq
MIRT2519046	hsa-miR-3663-5p	CLIP-seq
MIRT2519047	hsa-miR-3664-3p	CLIP-seq
MIRT2387094	hsa-miR-3692	CLIP-seq
MIRT2387095	hsa-miR-4430	CLIP-seq
MIRT2448508	hsa-miR-4493	CLIP-seq
MIRT2519048	hsa-miR-4496	CLIP-seq
MIRT2387096	hsa-miR-4505	CLIP-seq
MIRT2519049	hsa-miR-4527	CLIP-seq
MIRT2448509	hsa-miR-4646-5p	CLIP-seq
MIRT2387097	hsa-miR-4717-3p	CLIP-seq
MIRT2519050	hsa-miR-4740-3p	CLIP-seq
MIRT2448510	hsa-miR-4747-5p	CLIP-seq
MIRT2519051	hsa-miR-627	CLIP-seq
MIRT2519052	hsa-miR-653	CLIP-seq
MIRT2519053	hsa-miR-873	CLIP-seq
MIRT2679436	hsa-miR-1262	CLIP-seq
MIRT2387090	hsa-miR-128	CLIP-seq
MIRT2679437	hsa-miR-1293	CLIP-seq
MIRT2519040	hsa-miR-133a	CLIP-seq
MIRT2519041	hsa-miR-133b	CLIP-seq
MIRT2387091	hsa-miR-27a	CLIP-seq
MIRT2387092	hsa-miR-27b	CLIP-seq
MIRT2519042	hsa-miR-3064-3p	CLIP-seq
MIRT2519043	hsa-miR-3180-5p	CLIP-seq
MIRT2519045	hsa-miR-3614-5p	CLIP-seq
MIRT2387093	hsa-miR-3652	CLIP-seq
MIRT2519046	hsa-miR-3663-5p	CLIP-seq
MIRT2519047	hsa-miR-3664-3p	CLIP-seq
MIRT2679438	hsa-miR-3672	CLIP-seq
MIRT2387094	hsa-miR-3692	CLIP-seq
MIRT2387095	hsa-miR-4430	CLIP-seq
MIRT2679439	hsa-miR-4450	CLIP-seq
MIRT2679440	hsa-miR-4483	CLIP-seq
MIRT2448508	hsa-miR-4493	CLIP-seq
MIRT2519048	hsa-miR-4496	CLIP-seq
MIRT2387096	hsa-miR-4505	CLIP-seq
MIRT2519049	hsa-miR-4527	CLIP-seq
MIRT2448509	hsa-miR-4646-5p	CLIP-seq
MIRT2679441	hsa-miR-4701-3p	CLIP-seq
MIRT2387097	hsa-miR-4717-3p	CLIP-seq
MIRT2448510	hsa-miR-4747-5p	CLIP-seq
MIRT2679442	hsa-miR-491-5p	CLIP-seq
MIRT2519051	hsa-miR-627	CLIP-seq
MIRT2519052	hsa-miR-653	CLIP-seq
MIRT2519053	hsa-miR-873	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004164	Function	Diphthine synthase activity	EXP	3346227
GO:0004164	Function	Diphthine synthase activity	NAS	15485916
GO:0005575	Component	Cellular_component	ND
GO:0005829	Component	Cytosol	TAS
GO:0017183	Process	Peptidyl-diphthamide biosynthetic process from peptidyl-histidine	IEA
GO:0017183	Process	Peptidyl-diphthamide biosynthetic process from peptidyl-histidine	NAS	15485916
GO:0017183	Process	Peptidyl-diphthamide biosynthetic process from peptidyl-histidine	TAS
GO:0032259	Process	Methylation	IEA

MIM	HGNC	e!Ensembl
611075	24270	ENSG00000117543

Protein

UniProt ID

Q9H2P9

Protein name

Diphthine methyl ester synthase (EC 2.1.1.314) (Diphthamide biosynthesis methyltransferase)

Protein function

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive m

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00590	TP_methylase	1 → 241	Tetrapyrrole (Corrin/Porphyrin) Methylases	Domain

Sequence

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREE
VEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCC
GLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRK
IYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQM
CTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL

Sequence length

285

Interactions

View interactions

	Reactome
			Synthesis of diphthamide-EEF2

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Irritable Bowel Syndrome	Irritable Bowel Syndrome	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Ulcerative colitis	Ulcerative colitis	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Fibrocartilaginous embolism	Associate	39953636
Intervertebral Disc Degeneration	Associate	39953636

DPH5 (diphthamide biosynthesis 5)