Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51601
Gene name Gene Name - the full gene name approved by the HGNC.
Lipoyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LIPT1
Synonyms (NCBI Gene) Gene synonyms aliases
LIPT1D
Disease Acronyms (UniProt) Disease acronyms from UniProt database
LIPT1D
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety t
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005759 Component Mitochondrial matrix TAS
GO:0006464 Process Cellular protein modification process TAS 10103005
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610284 29569 ENSG00000144182
Protein
UniProt ID Q9Y234
Protein name Lipoyl amidotransferase LIPT1, mitochondrial (EC 2.3.1.200) (Lipoate biosynthesis protein) (Lipoate-protein ligase) (Lipoyl ligase) (Lipoyltransferase 1) (EC 2.3.1.-)
Protein function Lipoyl amidotransferase that catalyzes the transfer of lipoyl moieties from lipoyl-protein H of the glycine cleavage system (lipoyl-GCSH) to E2 subunits of the pyruvate dehydrogenase complex (PDCE2) (PubMed:29987032). Unable to catalyze the tran
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle and heart, moderately in kidney and pancreas, and detected at lower levels in liver, brain, placenta and lung. {ECO:0000269|PubMed:10103005}.
Sequence
MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGK
PILFFWQNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQ
IDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFI
DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLRTCPQDHKLNS
KWNILCEKIKGIM
Sequence length 373
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Lipoic acid metabolism
Metabolic pathways
Biosynthesis of cofactors
  Glyoxylate metabolism and glycine degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Cerebellar ataxia Progressive cerebellar ataxia rs28936415, rs199476133, rs540331226, rs797046006, rs863224069, rs138358708, rs1057519429, rs750959420, rs1568440440, rs1597846084, rs759460806, rs761486324, rs1240335250, rs1596489887
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Hypertrophic cardiomyopathy Hypertrophic Cardiomyopathy rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377
View all (752 more)
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Spastic tetraparesis Spastic tetraparesis ClinVar
Leigh Syndrome Leigh syndrome GenCC
Leigh Syndrome With Leukodystrophy Leigh syndrome with leukodystrophy GenCC
Associations from Text Mining
Disease Name Relationship Type References
Alpha ketoglutarate dehydrogenase deficiency Associate 24341803
Breast Neoplasms Associate 36213577, 36312586
Carcinoma Hepatocellular Associate 36195876, 37124062
Carcinoma Non Small Cell Lung Inhibit 38041690
Carcinoma Pancreatic Ductal Associate 36826087
Cerebral Infarction Associate 37983626
Compassion Fatigue Associate 24341803
Diabetes Mellitus Associate 37773841
Esophageal Squamous Cell Carcinoma Associate 37866660
Fabry Disease Associate 24341803