LSR (lipolysis stimulated lipoprotein receptor)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 51599
Gene name Lipolysis stimulated lipoprotein receptor
Gene symbol LSR
Synonyms (NCBI Gene)
ILDR3LISCH7
Chromosome 19
Chromosome location 19q13.12
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT051509 hsa-let-7e-5p CLASH 23622248
MIRT1121971 hsa-miR-205 CLIP-seq
MIRT1121972 hsa-miR-3671 CLIP-seq
MIRT1121973 hsa-miR-4255 CLIP-seq
MIRT1121974 hsa-miR-4302 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (24)
GO ID Ontology Definition Evidence Reference
GO:0001889 Process Liver development ISS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616582 29572 ENSG00000105699
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86X29
Protein name Lipolysis-stimulated lipoprotein receptor (Angulin-1)
Protein function Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity). Maintains epithelial barrier function b
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05624 LSR 259 → 306 Lipolysis stimulated receptor (LSR) Domain
Sequence 
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGL
GSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPT
QPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQ
GNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLG
RTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD
KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDV
DRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQA
GGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
RDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGS
EERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV
Sequence length 649
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colon adenocarcinoma Likely benign rs760163038 RCV005931289
Show/Hide Text Mining Associations (20)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36961882
Alzheimer Disease Associate 35347084
Breast Neoplasms Associate 24637461
Carcinogenesis Associate 24637461
Carcinoma Ductal Associate 24637461
Carcinoma Endometrioid Inhibit 35883247
Cytokine Release Syndrome Inhibit 33660567
Diabetes Mellitus Type 2 Stimulate 27036040
Endometrial Neoplasms Inhibit 27036040, 35883247
Endometrial Neoplasms Associate 28071680, 31782346