Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5159
Gene name Gene Name - the full gene name approved by the HGNC.	Platelet derived growth factor receptor beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDGFRB
Synonyms (NCBI Gene) Gene synonyms aliases	CD140B, IBGC4, IMF1, JTK12, KOGS, OPDKD, PDGFR, PDGFR-1, PDGFR1, PENTT
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q32
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs138008832	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs144050370	G>T	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs367543286	G>A	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs397509381	A>G	Pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs397509382	G>A	Pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs797044887	T>G	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs863224946	G>C	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs864309711	G>C,T	Likely-pathogenic, pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs1060499540	T>A,C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1060499541	->ATC	Pathogenic	Genic downstream transcript variant, inframe insertion, coding sequence variant
rs1060499542	A>G	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1060499543	CCTTCC>-	Pathogenic	Genic downstream transcript variant, inframe indel, coding sequence variant
rs1554108211	A>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs1554108389	T>C	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant

Show/Hide all(389)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000770	hsa-miR-224-5p	Microarray, Northern blot	16331254
MIRT053383	hsa-miR-34a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23805317
MIRT053383	hsa-miR-34a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23805317
MIRT053384	hsa-miR-34c-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23805317
MIRT053384	hsa-miR-34c-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23805317
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24837198
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24837198
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24837198
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24837198
MIRT437428	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23893664
MIRT437551	hsa-miR-29a-3p	Luciferase reporter assay	22745231
MIRT437557	hsa-miR-29b-3p	Luciferase reporter assay	22745231
MIRT437562	hsa-miR-29c-3p	Luciferase reporter assay	22745231
MIRT437573	hsa-miR-767-5p	Luciferase reporter assay	22745231
MIRT437557	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT437557	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT731562	hsa-miR-9-5p	Luciferase reporter assay	26896308
MIRT731562	hsa-miR-9-5p	Luciferase reporter assay	26896308
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26324236
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26324236
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26324236
MIRT053383	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26324236
MIRT1221247	hsa-miR-1200	CLIP-seq
MIRT1221248	hsa-miR-1252	CLIP-seq
MIRT1221249	hsa-miR-151-5p	CLIP-seq
MIRT1221250	hsa-miR-151b	CLIP-seq
MIRT1221251	hsa-miR-185	CLIP-seq
MIRT1221252	hsa-miR-193a-3p	CLIP-seq
MIRT1221253	hsa-miR-193b	CLIP-seq
MIRT1221254	hsa-miR-2355-5p	CLIP-seq
MIRT1221255	hsa-miR-3132	CLIP-seq
MIRT1221256	hsa-miR-3150b-3p	CLIP-seq
MIRT1221257	hsa-miR-3152-5p	CLIP-seq
MIRT1221258	hsa-miR-3194-5p	CLIP-seq
MIRT1221259	hsa-miR-3677-3p	CLIP-seq
MIRT1221260	hsa-miR-3918	CLIP-seq
MIRT1221261	hsa-miR-4269	CLIP-seq
MIRT1221262	hsa-miR-4306	CLIP-seq
MIRT1221263	hsa-miR-4323	CLIP-seq
MIRT1221264	hsa-miR-4324	CLIP-seq
MIRT1221265	hsa-miR-4640-3p	CLIP-seq
MIRT1221266	hsa-miR-4644	CLIP-seq
MIRT1221267	hsa-miR-4685-5p	CLIP-seq
MIRT1221268	hsa-miR-4784	CLIP-seq
MIRT1221269	hsa-miR-502-5p	CLIP-seq
MIRT1221270	hsa-miR-544b	CLIP-seq
MIRT1221271	hsa-miR-574-5p	CLIP-seq
MIRT1221272	hsa-miR-578	CLIP-seq
MIRT1221273	hsa-miR-759	CLIP-seq
MIRT1221274	hsa-miR-892b	CLIP-seq
MIRT1552189	hsa-miR-129-5p	CLIP-seq
MIRT1552190	hsa-miR-1915	CLIP-seq
MIRT1552191	hsa-miR-3179	CLIP-seq
MIRT1552192	hsa-miR-4726-3p	CLIP-seq
MIRT1552193	hsa-miR-4738-3p	CLIP-seq
MIRT1221272	hsa-miR-578	CLIP-seq
MIRT1552194	hsa-miR-579	CLIP-seq
MIRT1552195	hsa-miR-664	CLIP-seq
MIRT2063848	hsa-miR-1207-5p	CLIP-seq
MIRT2063849	hsa-miR-1909	CLIP-seq
MIRT2063850	hsa-miR-2861	CLIP-seq
MIRT1552191	hsa-miR-3179	CLIP-seq
MIRT2063851	hsa-miR-378g	CLIP-seq
MIRT2063852	hsa-miR-4456	CLIP-seq
MIRT2063853	hsa-miR-4488	CLIP-seq
MIRT2063854	hsa-miR-4640-5p	CLIP-seq
MIRT2063855	hsa-miR-4667-5p	CLIP-seq
MIRT2063856	hsa-miR-4697-5p	CLIP-seq
MIRT2063857	hsa-miR-4700-5p	CLIP-seq
MIRT2063858	hsa-miR-4726-5p	CLIP-seq
MIRT2063859	hsa-miR-4731-5p	CLIP-seq
MIRT2063860	hsa-miR-4763-3p	CLIP-seq
MIRT2063861	hsa-miR-486-3p	CLIP-seq
MIRT2063862	hsa-miR-541	CLIP-seq
MIRT2063863	hsa-miR-637	CLIP-seq
MIRT2063864	hsa-miR-654-5p	CLIP-seq
MIRT1221273	hsa-miR-759	CLIP-seq
MIRT1221248	hsa-miR-1252	CLIP-seq
MIRT1221261	hsa-miR-4269	CLIP-seq
MIRT2063853	hsa-miR-4488	CLIP-seq
MIRT2063856	hsa-miR-4697-5p	CLIP-seq
MIRT2063859	hsa-miR-4731-5p	CLIP-seq
MIRT2063863	hsa-miR-637	CLIP-seq
MIRT1221273	hsa-miR-759	CLIP-seq
MIRT1221274	hsa-miR-892b	CLIP-seq
MIRT2432055	hsa-miR-1179	CLIP-seq
MIRT2432056	hsa-miR-146a	CLIP-seq
MIRT2432057	hsa-miR-146b-5p	CLIP-seq
MIRT2432058	hsa-miR-1470	CLIP-seq
MIRT2432059	hsa-miR-186	CLIP-seq
MIRT1552190	hsa-miR-1915	CLIP-seq
MIRT2432060	hsa-miR-3133	CLIP-seq
MIRT2432061	hsa-miR-3189-3p	CLIP-seq
MIRT2432062	hsa-miR-326	CLIP-seq
MIRT2432063	hsa-miR-330-5p	CLIP-seq
MIRT2432064	hsa-miR-3619-3p	CLIP-seq
MIRT2432065	hsa-miR-4287	CLIP-seq
MIRT2432066	hsa-miR-4424	CLIP-seq
MIRT2432067	hsa-miR-4432	CLIP-seq
MIRT2432068	hsa-miR-4450	CLIP-seq
MIRT2432069	hsa-miR-4461	CLIP-seq
MIRT2432070	hsa-miR-4469	CLIP-seq
MIRT2432071	hsa-miR-4499	CLIP-seq
MIRT2432072	hsa-miR-4535	CLIP-seq
MIRT2432073	hsa-miR-4639-3p	CLIP-seq
MIRT2432074	hsa-miR-4667-3p	CLIP-seq
MIRT2063855	hsa-miR-4667-5p	CLIP-seq
MIRT2432075	hsa-miR-4685-3p	CLIP-seq
MIRT2063857	hsa-miR-4700-5p	CLIP-seq
MIRT2432076	hsa-miR-4713-3p	CLIP-seq
MIRT2432077	hsa-miR-4718	CLIP-seq
MIRT1552192	hsa-miR-4726-3p	CLIP-seq
MIRT2432078	hsa-miR-4776-5p	CLIP-seq
MIRT2432079	hsa-miR-499-5p	CLIP-seq
MIRT2432080	hsa-miR-544	CLIP-seq
MIRT2432081	hsa-miR-548c-3p	CLIP-seq
MIRT2432082	hsa-miR-568	CLIP-seq
MIRT2432083	hsa-miR-580	CLIP-seq
MIRT2432084	hsa-miR-589	CLIP-seq
MIRT2063863	hsa-miR-637	CLIP-seq
MIRT2439303	hsa-miR-181a	CLIP-seq
MIRT2439304	hsa-miR-181b	CLIP-seq
MIRT2439305	hsa-miR-181c	CLIP-seq
MIRT2439306	hsa-miR-181d	CLIP-seq
MIRT2439307	hsa-miR-1972	CLIP-seq
MIRT2439308	hsa-miR-204	CLIP-seq
MIRT2439309	hsa-miR-211	CLIP-seq
MIRT2439310	hsa-miR-2355-3p	CLIP-seq
MIRT2439311	hsa-miR-3157-3p	CLIP-seq
MIRT2439312	hsa-miR-3940-3p	CLIP-seq
MIRT2439313	hsa-miR-4262	CLIP-seq
MIRT2439314	hsa-miR-4290	CLIP-seq
MIRT2439315	hsa-miR-4646-3p	CLIP-seq
MIRT2439316	hsa-miR-4650-5p	CLIP-seq
MIRT2063855	hsa-miR-4667-5p	CLIP-seq
MIRT2063857	hsa-miR-4700-5p	CLIP-seq
MIRT2439317	hsa-miR-4706	CLIP-seq
MIRT2439318	hsa-miR-4749-5p	CLIP-seq
MIRT2439319	hsa-miR-4755-3p	CLIP-seq
MIRT2439320	hsa-miR-4768-3p	CLIP-seq
MIRT2439321	hsa-miR-665	CLIP-seq
MIRT2439322	hsa-miR-671-5p	CLIP-seq
MIRT2439323	hsa-miR-744	CLIP-seq
MIRT2439324	hsa-miR-874	CLIP-seq
MIRT2590341	hsa-miR-1182	CLIP-seq
MIRT2590342	hsa-miR-1193	CLIP-seq
MIRT2590343	hsa-miR-1236	CLIP-seq
MIRT2590344	hsa-miR-124	CLIP-seq
MIRT2590345	hsa-miR-1246	CLIP-seq
MIRT1221248	hsa-miR-1252	CLIP-seq
MIRT2590346	hsa-miR-1255a	CLIP-seq
MIRT2590347	hsa-miR-1255b	CLIP-seq
MIRT2590348	hsa-miR-1273f	CLIP-seq
MIRT2590349	hsa-miR-1299	CLIP-seq
MIRT2590350	hsa-miR-1301	CLIP-seq
MIRT2590351	hsa-miR-1321	CLIP-seq
MIRT2590352	hsa-miR-141	CLIP-seq
MIRT2590353	hsa-miR-143	CLIP-seq
MIRT2590354	hsa-miR-1587	CLIP-seq
MIRT2439303	hsa-miR-181a	CLIP-seq
MIRT2439304	hsa-miR-181b	CLIP-seq
MIRT2439305	hsa-miR-181c	CLIP-seq
MIRT2439306	hsa-miR-181d	CLIP-seq
MIRT2590355	hsa-miR-1827	CLIP-seq
MIRT2432059	hsa-miR-186	CLIP-seq
MIRT2590356	hsa-miR-1914	CLIP-seq
MIRT2590357	hsa-miR-19a	CLIP-seq
MIRT2590358	hsa-miR-19b	CLIP-seq
MIRT2590359	hsa-miR-200a	CLIP-seq
MIRT2590360	hsa-miR-208a	CLIP-seq
MIRT2590361	hsa-miR-208b	CLIP-seq
MIRT2590362	hsa-miR-2110	CLIP-seq
MIRT2590363	hsa-miR-2116	CLIP-seq
MIRT2590364	hsa-miR-224	CLIP-seq
MIRT2590365	hsa-miR-2392	CLIP-seq
MIRT2063850	hsa-miR-2861	CLIP-seq
MIRT2590366	hsa-miR-2909	CLIP-seq
MIRT2590367	hsa-miR-31	CLIP-seq
MIRT2590368	hsa-miR-3119	CLIP-seq
MIRT2590369	hsa-miR-3128	CLIP-seq
MIRT2432060	hsa-miR-3133	CLIP-seq
MIRT2590370	hsa-miR-3134	CLIP-seq
MIRT2590371	hsa-miR-3144-5p	CLIP-seq
MIRT1221256	hsa-miR-3150b-3p	CLIP-seq
MIRT2590372	hsa-miR-3157-5p	CLIP-seq
MIRT2590373	hsa-miR-3160-5p	CLIP-seq
MIRT2590374	hsa-miR-3162-5p	CLIP-seq
MIRT2590375	hsa-miR-3165	CLIP-seq
MIRT2590376	hsa-miR-3169	CLIP-seq
MIRT2590377	hsa-miR-3176	CLIP-seq
MIRT2590378	hsa-miR-3182	CLIP-seq
MIRT2590379	hsa-miR-3191	CLIP-seq
MIRT2590380	hsa-miR-361-3p	CLIP-seq
MIRT2590381	hsa-miR-365	CLIP-seq
MIRT2590382	hsa-miR-3672	CLIP-seq
MIRT2590383	hsa-miR-3691-5p	CLIP-seq
MIRT2590384	hsa-miR-378	CLIP-seq
MIRT2590385	hsa-miR-378b	CLIP-seq
MIRT2590386	hsa-miR-378c	CLIP-seq
MIRT2590387	hsa-miR-378d	CLIP-seq
MIRT2590388	hsa-miR-378e	CLIP-seq
MIRT2590389	hsa-miR-378f	CLIP-seq
MIRT2063851	hsa-miR-378g	CLIP-seq
MIRT2590390	hsa-miR-378h	CLIP-seq
MIRT2590391	hsa-miR-378i	CLIP-seq
MIRT2590392	hsa-miR-3922-3p	CLIP-seq
MIRT2590393	hsa-miR-3922-5p	CLIP-seq
MIRT2590394	hsa-miR-3944-5p	CLIP-seq
MIRT2590395	hsa-miR-3975	CLIP-seq
MIRT2590396	hsa-miR-3977	CLIP-seq
MIRT2590397	hsa-miR-422a	CLIP-seq
MIRT2439313	hsa-miR-4262	CLIP-seq
MIRT2590398	hsa-miR-4270	CLIP-seq
MIRT2590399	hsa-miR-4271	CLIP-seq
MIRT2590400	hsa-miR-4299	CLIP-seq
MIRT2590401	hsa-miR-4305	CLIP-seq
MIRT1221263	hsa-miR-4323	CLIP-seq
MIRT2432067	hsa-miR-4432	CLIP-seq
MIRT2590402	hsa-miR-4441	CLIP-seq
MIRT2063852	hsa-miR-4456	CLIP-seq
MIRT2590403	hsa-miR-4463	CLIP-seq
MIRT2590404	hsa-miR-4473	CLIP-seq
MIRT2063853	hsa-miR-4488	CLIP-seq
MIRT2590405	hsa-miR-4492	CLIP-seq
MIRT2590406	hsa-miR-4498	CLIP-seq
MIRT2432071	hsa-miR-4499	CLIP-seq
MIRT2590407	hsa-miR-4505	CLIP-seq
MIRT2590408	hsa-miR-4522	CLIP-seq
MIRT2590409	hsa-miR-4530	CLIP-seq
MIRT2590410	hsa-miR-4638-3p	CLIP-seq
MIRT2432073	hsa-miR-4639-3p	CLIP-seq
MIRT2590411	hsa-miR-4642	CLIP-seq
MIRT2590412	hsa-miR-4652-5p	CLIP-seq
MIRT2590413	hsa-miR-4656	CLIP-seq
MIRT2590414	hsa-miR-4659a-3p	CLIP-seq
MIRT2590415	hsa-miR-4659b-3p	CLIP-seq
MIRT2590416	hsa-miR-4660	CLIP-seq
MIRT2063855	hsa-miR-4667-5p	CLIP-seq
MIRT2590417	hsa-miR-4671-3p	CLIP-seq
MIRT2590418	hsa-miR-4675	CLIP-seq
MIRT2590419	hsa-miR-4677-5p	CLIP-seq
MIRT2590420	hsa-miR-4691-3p	CLIP-seq
MIRT2063856	hsa-miR-4697-5p	CLIP-seq
MIRT2063857	hsa-miR-4700-5p	CLIP-seq
MIRT2439317	hsa-miR-4706	CLIP-seq
MIRT2590421	hsa-miR-4708-3p	CLIP-seq
MIRT2590422	hsa-miR-4708-5p	CLIP-seq
MIRT2590423	hsa-miR-4725-3p	CLIP-seq
MIRT2063859	hsa-miR-4731-5p	CLIP-seq
MIRT2590424	hsa-miR-4739	CLIP-seq
MIRT2590425	hsa-miR-4740-5p	CLIP-seq
MIRT2590426	hsa-miR-4741	CLIP-seq
MIRT2590427	hsa-miR-4747-3p	CLIP-seq
MIRT2439318	hsa-miR-4749-5p	CLIP-seq
MIRT2590428	hsa-miR-4756-5p	CLIP-seq
MIRT2590429	hsa-miR-4770	CLIP-seq
MIRT2590430	hsa-miR-4777-5p	CLIP-seq
MIRT2590431	hsa-miR-4782-5p	CLIP-seq
MIRT1221268	hsa-miR-4784	CLIP-seq
MIRT2432079	hsa-miR-499-5p	CLIP-seq
MIRT2590432	hsa-miR-5047	CLIP-seq
MIRT2590433	hsa-miR-506	CLIP-seq
MIRT2590434	hsa-miR-512-3p	CLIP-seq
MIRT2590435	hsa-miR-516b	CLIP-seq
MIRT2590436	hsa-miR-518d-5p	CLIP-seq
MIRT2590437	hsa-miR-519b-5p	CLIP-seq
MIRT2590438	hsa-miR-519c-5p	CLIP-seq
MIRT2590439	hsa-miR-520c-5p	CLIP-seq
MIRT2590440	hsa-miR-520f	CLIP-seq
MIRT2590441	hsa-miR-526a	CLIP-seq
MIRT2590442	hsa-miR-526b	CLIP-seq
MIRT2590443	hsa-miR-548q	CLIP-seq
MIRT2590444	hsa-miR-619	CLIP-seq
MIRT2063863	hsa-miR-637	CLIP-seq
MIRT2590445	hsa-miR-661	CLIP-seq
MIRT2590446	hsa-miR-668	CLIP-seq
MIRT2439323	hsa-miR-744	CLIP-seq
MIRT1221273	hsa-miR-759	CLIP-seq
MIRT2590447	hsa-miR-762	CLIP-seq
MIRT2590448	hsa-miR-765	CLIP-seq
MIRT2590449	hsa-miR-767-3p	CLIP-seq
MIRT1221274	hsa-miR-892b	CLIP-seq
MIRT2590346	hsa-miR-1255a	CLIP-seq
MIRT2590347	hsa-miR-1255b	CLIP-seq
MIRT2590348	hsa-miR-1273f	CLIP-seq
MIRT2590349	hsa-miR-1299	CLIP-seq
MIRT2590350	hsa-miR-1301	CLIP-seq
MIRT2590351	hsa-miR-1321	CLIP-seq
MIRT2590352	hsa-miR-141	CLIP-seq
MIRT2590353	hsa-miR-143	CLIP-seq
MIRT2590354	hsa-miR-1587	CLIP-seq
MIRT2439303	hsa-miR-181a	CLIP-seq
MIRT2439304	hsa-miR-181b	CLIP-seq
MIRT2439305	hsa-miR-181c	CLIP-seq
MIRT2439306	hsa-miR-181d	CLIP-seq
MIRT2590355	hsa-miR-1827	CLIP-seq
MIRT2590356	hsa-miR-1914	CLIP-seq
MIRT2439307	hsa-miR-1972	CLIP-seq
MIRT2590359	hsa-miR-200a	CLIP-seq
MIRT2590362	hsa-miR-2110	CLIP-seq
MIRT2590363	hsa-miR-2116	CLIP-seq
MIRT2590364	hsa-miR-224	CLIP-seq
MIRT2590365	hsa-miR-2392	CLIP-seq
MIRT2063850	hsa-miR-2861	CLIP-seq
MIRT2590366	hsa-miR-2909	CLIP-seq
MIRT2590368	hsa-miR-3119	CLIP-seq
MIRT2687475	hsa-miR-3126-5p	CLIP-seq
MIRT2590371	hsa-miR-3144-5p	CLIP-seq
MIRT1221256	hsa-miR-3150b-3p	CLIP-seq
MIRT2590372	hsa-miR-3157-5p	CLIP-seq
MIRT2590373	hsa-miR-3160-5p	CLIP-seq
MIRT2590374	hsa-miR-3162-5p	CLIP-seq
MIRT2590377	hsa-miR-3176	CLIP-seq
MIRT1552191	hsa-miR-3179	CLIP-seq
MIRT2590378	hsa-miR-3182	CLIP-seq
MIRT2590379	hsa-miR-3191	CLIP-seq
MIRT2687476	hsa-miR-3202	CLIP-seq
MIRT2590380	hsa-miR-361-3p	CLIP-seq
MIRT2687477	hsa-miR-3622b-5p	CLIP-seq
MIRT2590381	hsa-miR-365	CLIP-seq
MIRT2590382	hsa-miR-3672	CLIP-seq
MIRT2590384	hsa-miR-378	CLIP-seq
MIRT2590385	hsa-miR-378b	CLIP-seq
MIRT2590386	hsa-miR-378c	CLIP-seq
MIRT2590387	hsa-miR-378d	CLIP-seq
MIRT2590388	hsa-miR-378e	CLIP-seq
MIRT2590389	hsa-miR-378f	CLIP-seq
MIRT2063851	hsa-miR-378g	CLIP-seq
MIRT2590390	hsa-miR-378h	CLIP-seq
MIRT2590391	hsa-miR-378i	CLIP-seq
MIRT2590392	hsa-miR-3922-3p	CLIP-seq
MIRT2590393	hsa-miR-3922-5p	CLIP-seq
MIRT2590394	hsa-miR-3944-5p	CLIP-seq
MIRT2590396	hsa-miR-3977	CLIP-seq
MIRT2590397	hsa-miR-422a	CLIP-seq
MIRT2687478	hsa-miR-4253	CLIP-seq
MIRT2439313	hsa-miR-4262	CLIP-seq
MIRT2590398	hsa-miR-4270	CLIP-seq
MIRT2590399	hsa-miR-4271	CLIP-seq
MIRT2687479	hsa-miR-4419a	CLIP-seq
MIRT2590402	hsa-miR-4441	CLIP-seq
MIRT2590403	hsa-miR-4463	CLIP-seq
MIRT2063853	hsa-miR-4488	CLIP-seq
MIRT2590405	hsa-miR-4492	CLIP-seq
MIRT2590406	hsa-miR-4498	CLIP-seq
MIRT2590407	hsa-miR-4505	CLIP-seq
MIRT2687480	hsa-miR-4510	CLIP-seq
MIRT2590409	hsa-miR-4530	CLIP-seq
MIRT2590410	hsa-miR-4638-3p	CLIP-seq
MIRT2432073	hsa-miR-4639-3p	CLIP-seq
MIRT2590411	hsa-miR-4642	CLIP-seq
MIRT2590412	hsa-miR-4652-5p	CLIP-seq
MIRT2590413	hsa-miR-4656	CLIP-seq
MIRT2590414	hsa-miR-4659a-3p	CLIP-seq
MIRT2590415	hsa-miR-4659b-3p	CLIP-seq
MIRT2590416	hsa-miR-4660	CLIP-seq
MIRT2063855	hsa-miR-4667-5p	CLIP-seq
MIRT2590418	hsa-miR-4675	CLIP-seq
MIRT2590419	hsa-miR-4677-5p	CLIP-seq
MIRT2687481	hsa-miR-4688	CLIP-seq
MIRT2590420	hsa-miR-4691-3p	CLIP-seq
MIRT2687482	hsa-miR-4691-5p	CLIP-seq
MIRT2063856	hsa-miR-4697-5p	CLIP-seq
MIRT2063857	hsa-miR-4700-5p	CLIP-seq
MIRT2439317	hsa-miR-4706	CLIP-seq
MIRT2590422	hsa-miR-4708-5p	CLIP-seq
MIRT2687483	hsa-miR-4710	CLIP-seq
MIRT2590423	hsa-miR-4725-3p	CLIP-seq
MIRT2063859	hsa-miR-4731-5p	CLIP-seq
MIRT2590424	hsa-miR-4739	CLIP-seq
MIRT2590426	hsa-miR-4741	CLIP-seq
MIRT2590427	hsa-miR-4747-3p	CLIP-seq
MIRT2687484	hsa-miR-4747-5p	CLIP-seq
MIRT2439318	hsa-miR-4749-5p	CLIP-seq
MIRT2590428	hsa-miR-4756-5p	CLIP-seq
MIRT2590429	hsa-miR-4770	CLIP-seq
MIRT2590431	hsa-miR-4782-5p	CLIP-seq
MIRT1221268	hsa-miR-4784	CLIP-seq
MIRT2590432	hsa-miR-5047	CLIP-seq
MIRT2590435	hsa-miR-516b	CLIP-seq
MIRT2590442	hsa-miR-526b	CLIP-seq
MIRT2063863	hsa-miR-637	CLIP-seq
MIRT2590445	hsa-miR-661	CLIP-seq
MIRT2590446	hsa-miR-668	CLIP-seq
MIRT2439323	hsa-miR-744	CLIP-seq
MIRT2590447	hsa-miR-762	CLIP-seq
MIRT2590448	hsa-miR-765	CLIP-seq
MIRT2590449	hsa-miR-767-3p	CLIP-seq
MIRT1221274	hsa-miR-892b	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
TP53	Activation	18697203
ZNF24	Repression	20510677

Show/Hide all(97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IBA
GO:0004672	Function	Protein kinase activity	IDA	1314164
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	1653029
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004992	Function	Platelet activating factor receptor activity	TAS	2536956
GO:0005017	Function	Platelet-derived growth factor receptor activity	IEA
GO:0005017	Function	Platelet-derived growth factor receptor activity	TAS	2536956
GO:0005019	Function	Platelet-derived growth factor beta-receptor activity	IBA
GO:0005019	Function	Platelet-derived growth factor beta-receptor activity	IDA	1314164, 2536956, 2850496
GO:0005019	Function	Platelet-derived growth factor beta-receptor activity	IEA
GO:0005019	Function	Platelet-derived growth factor beta-receptor activity	IMP	2554309, 26599395
GO:0005096	Function	GTPase activator activity	IMP	1653029
GO:0005102	Function	Signaling receptor binding	IPI	10821867
GO:0005161	Function	Platelet-derived growth factor receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	2542288
GO:0005515	Function	Protein binding	IPI	1314164, 1330535, 1334459, 1375321, 1396585, 1661130, 2157284, 7530043, 7536927, 7545675, 7679113, 7680644, 7683666, 7685273, 7687537, 7688466, 7692233, 7876130, 8119896, 8181064, 8183548, 8382612, 8382774, 8538796, 8555205, 8564419, 8670861, 8940081, 9153411, 9355745, 9512716, 9742401
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	2554309
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IDA	10821867
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	2554309
GO:0014805	Process	Smooth muscle adaptation	NAS	16477012
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IBA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IMP	21679854
GO:0014911	Process	Positive regulation of smooth muscle cell migration	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	16477012
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	2850496
GO:0019899	Function	Enzyme binding	IPI	26315405
GO:0019901	Function	Protein kinase binding	IPI	16479011
GO:0030335	Process	Positive regulation of cell migration	IDA	17470632
GO:0030335	Process	Positive regulation of cell migration	IMP	2554309
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0035441	Process	Cell migration involved in vasculogenesis	ISS
GO:0035791	Process	Platelet-derived growth factor receptor-beta signaling pathway	IMP	2554309, 26599395
GO:0035793	Process	Positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway	ISS
GO:0035909	Process	Aorta morphogenesis	ISS
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038085	Function	Vascular endothelial growth factor binding	IEA
GO:0038085	Function	Vascular endothelial growth factor binding	IPI	17470632
GO:0038091	Process	Positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IDA	17470632
GO:0038091	Process	Positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IEA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043406	Process	Positive regulation of MAP kinase activity	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	ISS
GO:0046777	Process	Protein autophosphorylation	IDA	2850496
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IDA	1314164, 2536956, 16477012
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048407	Function	Platelet-derived growth factor binding	IBA
GO:0048407	Function	Platelet-derived growth factor binding	IDA	2554309, 2850496
GO:0048407	Function	Platelet-derived growth factor binding	IPI	2536956
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IMP	21679854
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	2554309
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	1314164, 16477012
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0055003	Process	Cardiac myofibril assembly	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060326	Process	Cell chemotaxis	IDA	2554309, 17991872
GO:0060981	Process	Cell migration involved in coronary angiogenesis	ISS
GO:0061298	Process	Retina vasculature development in camera-type eye	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21679854
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0071670	Process	Smooth muscle cell chemotaxis	ISS
GO:0072262	Process	Metanephric glomerular mesangial cell proliferation involved in metanephros development	ISS
GO:0072277	Process	Metanephric glomerular capillary formation	ISS
GO:0090280	Process	Positive regulation of calcium ion import	ISS
GO:0160185	Function	Phospholipase C activator activity	IEA
GO:0160185	Function	Phospholipase C activator activity	IMP	1653029
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	ISS
GO:2000573	Process	Positive regulation of DNA biosynthetic process	ISS

MIM	HGNC	e!Ensembl
173410	8804	ENSG00000113721

Protein

UniProt ID

P09619

Protein name

Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor r

Protein function

Tyrosine-protein kinase that acts as a cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, di

PDB

1GQ5 , 1H9O , 1SHA , 2IUI , 2L6W , 2PLD , 2PLE , 3MJG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00047	ig	37 → 114	Immunoglobulin domain	Domain
PF13927	Ig_3	213 → 295		Domain
PF07679	I-set	327 → 413	Immunoglobulin I-set domain	Domain
PF07714	PK_Tyr_Ser-Thr	600 → 958	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL

Sequence length

1106

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway Phospholipase D signaling pathway PI3K-Akt signaling pathway Focal adhesion Gap junction JAK-STAT signaling pathway Regulation of actin cytoskeleton Human papillomavirus infection Pathways in cancer MicroRNAs in cancer Glioma Prostate cancer Melanoma Central carbon metabolism in cancer Choline metabolism in cancer		PIP3 activates AKT signaling Downstream signal transduction Signaling by PDGF Constitutive Signaling by Aberrant PI3K in Cancer RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Show/Hide Causal Diseases (5)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Basal ganglia calcification	basal ganglia calcification, idiopathic, 4	rs397509381, rs367543286	N/A
Myofibromatosis	myofibromatosis, infantile, 1	rs367543286, rs864309711, rs1554108389	N/A
myofibromatosis	infantile myofibromatosis	rs1060499541, rs1060499540, rs367543286, rs864309711, rs1060499543	N/A
Skeletal Overgrowth-Craniofacial Dysmorphism-Hyperelastic Skin-White Matter Lesions Syndrome	skeletal overgrowth-craniofacial dysmorphism-hyperelastic skin-white matter lesions syndrome	rs863224946	N/A
Aging syndrome	acroosteolysis-keloid-like lesions-premature aging syndrome	rs1554108211	N/A

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bilateral Striopallidodentate Calcinosis	bilateral striopallidodentate calcinosis	N/A	N/A	GenCC
Cerebral palsy	cerebral palsy	N/A	N/A	ClinVar
Histiocytosis	hereditary progressive mucinous histiocytosis	N/A	N/A	GenCC
Microcephaly	microcephaly	N/A	N/A	ClinVar
Parkinson disease	Parkinsonian disorder	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (251)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acro Osteolysis	Associate	30573803, 35689379
Adenocarcinoma	Associate	21751195, 31308421
Adenoma	Stimulate	20358421
Adrenocortical Carcinoma	Associate	25078331
Aging Premature	Associate	30573803, 33450762
Aicardi Goutieres syndrome	Associate	24796542
Alzheimer Disease	Associate	35695802, 37137722, 37264161
Aneurysm	Associate	31031011, 35156398, 35689379
Angiofibroma	Associate	35216046
Angiomyoma	Associate	26085647, 37889065
Arteriosclerosis Obliterans	Associate	26159387
Astrocytoma	Associate	17695499
Atherosclerosis	Associate	16876267, 17344284, 30571344
Biliary Tract Neoplasms	Associate	25446376
Brain Diseases	Associate	26872634
Brain Injuries	Associate	30636077
Brain Injury Chronic	Associate	18187181
Brain Neoplasms	Associate	26277786
Breast Neoplasms	Associate	16288304, 17121430, 18515258, 19073506, 20691121, 22865780, 23374223, 24418100, 25805799, 25971960, 26163388, 27449045, 27881889, 28260860, 31542979, 33661437, 37217880 View all (2 more)
Bronchiolitis Obliterans Syndrome	Associate	17363728
Bronchopulmonary Dysplasia	Associate	30459472
CADASIL	Associate	25303037, 32188464
Calcinosis	Associate	30656188
Calcinosis Cutis	Associate	23401071, 29377550
Carcinogenesis	Associate	23805317, 24837198, 25257795, 32235327, 34837064
Carcinoid Tumor	Associate	16612146
Carcinoma Basal Cell	Associate	28987144
Carcinoma Hepatocellular	Associate	21574155, 23552472, 23785399, 31514484
Carcinoma Non Small Cell Lung	Associate	21729646, 21892101, 23033932, 23805317, 23947765
Carcinoma Ovarian Epithelial	Associate	18075302, 30977516
Carcinoma Pancreatic Ductal	Associate	36047966, 36849201
Carcinoma Renal Cell	Stimulate	21729646
Carcinoma Renal Cell	Associate	25550804, 26215891, 27931046, 30446580, 35637958, 38378000
Cardiomyopathies	Associate	37833902
Cardiomyopathy Dilated	Associate	31316208
Carotid Artery Diseases	Associate	30571344
Carotid Artery Injuries	Associate	18187181
Carpal Tunnel Syndrome	Associate	29170419
Castleman Disease	Associate	37839777
Cerebellar Hypoplasia	Associate	31474318
Cerebral Infarction	Associate	37794518
Chlamydia Infections	Associate	30718536
Cholangiocarcinoma	Associate	37307823
Chondrosarcoma	Associate	20925044
Chondrosarcoma Mesenchymal	Associate	34837064
Chordoma	Associate	19570961, 20164240, 26247786, 32011476
Chromosome Aberrations	Associate	18421200, 26279204, 34859285
Chronic Disease	Associate	12181402, 18421200
Cockayne Syndrome	Associate	30573803
Cognition Disorders	Associate	29955172
Colorectal Neoplasms	Associate	19098285, 20358421, 23146028, 23900414, 24023735, 24504536, 24687888, 26553611, 27248825, 35715570, 36264073, 37122535
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28726812
Corneal Diseases	Associate	30573803
Corneal Injuries	Associate	37934158
Coronary Aneurysm	Associate	35156398
Coronary Artery Disease	Associate	30844764, 39909455
COVID 19	Associate	35163504
Death	Associate	30841447, 35156398
Dementia	Associate	26407747, 37137722
Dermatofibrosarcoma	Associate	14633610, 17431412, 20439456, 23922791, 29955147, 34362454, 38641030
Desmoid disease hereditary	Associate	37943631
Desmoplastic Small Round Cell Tumor	Associate	15389255
Diabetes Gestational	Associate	20144210
Disease	Stimulate	28952224
Disease Progression	Associate	18794102
Dissection Thoracic Aorta	Stimulate	29685513
Drug Related Side Effects and Adverse Reactions	Associate	21803746
Endometrial Neoplasms	Associate	19228591, 37716459
Endometrial Stromal Tumors	Associate	23221606
Eosinophilia	Associate	12181402, 15087377, 19472396, 20107158, 22271894, 22926771, 24687085, 31327842, 32386029, 33022638, 33421986, 33663081, 33990705, 34533850, 34859285, 35689379, 40474715 View all (2 more)
Epiretinal Membrane	Associate	19032953
Esophageal Neoplasms	Associate	28147311
Facies	Associate	26279204
Fahr's disease	Associate	24796542, 25211641, 25292412, 26279204, 28935882, 29955172, 33714066, 33793087, 36862146
Fibroma Desmoplastic	Stimulate	26163388
Fibromatosis Aggressive	Associate	37943631
Fibromatosis Congenital Generalized	Associate	23731537, 23731542, 28183292, 30200486, 30573803, 32888134, 35689379
Fibrosis	Associate	17363728, 19180499, 35163504, 37995775
Gastrointestinal Stromal Tumors	Associate	15822120, 17659683, 25557174, 33524869, 34876394
Giant Cell Tumor of Bone	Associate	36091939
Glioblastoma	Associate	12881526, 15727903, 19275932, 19915670, 21536039, 21691733, 24023874, 25257795, 25380967, 26461476, 26857280, 34875133, 35980802
Glioma	Associate	16760646, 18519768, 25257795, 27764516, 28534507, 31794427, 35642016, 36275907, 37980347
Glioma	Inhibit	27852048
Gliosarcoma	Associate	16373964
Glomerulonephritis IGA	Stimulate	8995734
Glomerulosclerosis Focal Segmental	Stimulate	8995734
Glomus Tumor	Associate	36788105
Glucocorticoid Receptor Deficiency	Associate	29133777
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417
Glut1 Deficiency Syndrome	Associate	37137722, 39847894
Graft vs Host Disease	Associate	22356850
Hemangiosarcoma	Associate	33016928
Hematologic Neoplasms	Associate	12842979, 23497317, 29133777
Hematoma Subdural Chronic	Associate	38030262
Heredodegenerative Disorders Nervous System	Associate	25292412
Holoprosencephaly recurrent infections and monocytosis	Associate	33022638
Holt Oram syndrome	Associate	32580247
Hydatidiform Mole	Inhibit	25849742
Hypereosinophilic Syndrome	Associate	25599554
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	39847894
Hypertension	Associate	23033932
Hypertension Pulmonary	Associate	32634060
Hypertrophy	Associate	28951244
Hypothyroidism Congenital Nongoitrous 2	Associate	32761670
Hypoxia	Associate	23788753
Idiopathic basal ganglia calcification childhood onset	Associate	25292412
Idiopathic Pulmonary Fibrosis	Associate	25496490, 30335500
Infections	Inhibit	17727656
Inflammation	Associate	19968886, 24434780, 39385222
Intracranial Aneurysm	Associate	35156398
Keloid	Associate	33450762
Kidney Neoplasms	Associate	32413049
Leiomyosarcoma	Associate	16681772, 23334251, 25340839
Leukemia	Associate	12181402, 17325341, 19880494, 22204395, 22262849, 28555080, 29434033, 7761424, 9373237
Leukemia B Cell	Associate	37196217
Leukemia Biphenotypic Acute	Associate	24628626
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11389034, 22271894, 23497317, 31327842, 33022638
Leukemia Myeloid	Associate	32386029
Leukemia Myeloid Acute	Associate	22356850, 30959925, 33663081, 9373237
Leukemia Myelomonocytic Chronic	Associate	7761424, 9057655
Leukemia Myelomonocytic Juvenile	Associate	30697976
Leukemia Promyelocytic Acute	Associate	18571505
Leukocytosis	Associate	12181402, 33022638
Leukodystrophy Metachromatic	Associate	34082828
Light Fixation Seizure Syndrome	Associate	33990705, 40474715
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Associate	35689379
Lipodystrophy	Associate	30573803
Liposarcoma	Associate	30824765
Livedoid Vasculopathy	Associate	19180499
Liver Cirrhosis	Associate	15591520, 23552472, 37001365
Liver Diseases	Associate	37001365
Lung Diseases Interstitial	Associate	32386029
Lung Injury	Associate	28471683
Lung Neoplasms	Associate	1315044, 20354211, 21729646, 23805317
Lymphatic Metastasis	Stimulate	22403002, 32235327, 33884652
Lymphatic Metastasis	Associate	37307823
Lymphoma	Associate	22356850, 30105844, 31327842, 34533850, 34859285, 37454239, 40474715, 40533930
Lymphoma B Cell Marginal Zone	Associate	33421986
Lymphoma Large B Cell Diffuse	Associate	31804739
Lymphoma Non Hodgkin	Associate	18519768, 23188435
Lymphoma T Cell	Associate	37160920
Mastocytosis Systemic	Associate	23497317, 33663081
Medulloblastoma	Associate	17039417, 19417143, 24190638, 25576913, 29377550
Melanoma	Associate	16565971, 21107323, 21803746, 23382862, 27102439
Melanoma	Inhibit	26277786
Meningioma	Associate	23047550
Mental Disorders	Associate	25211641, 25809424, 29955172, 36862146
Mesothelioma	Associate	17311837, 24747001
Mesothelioma Malignant	Associate	24747001, 33955203
Migraine Disorders	Associate	33793087
Mouth Neoplasms	Associate	36849997
Multiple Myeloma	Associate	28952224
Myelodysplastic Myeloproliferative Diseases	Associate	12542482
Myelodysplastic Syndromes	Associate	25472472
Myeloproliferative Disorders	Associate	12907457, 15087377, 18757400
Myofibroma	Associate	31478943, 32604167, 36788105
Myofibromatosis	Associate	26279204, 28726812, 39973527
Myopericytoma	Associate	26085647, 31478943, 32604167, 36788105
Neointima	Associate	35156398
Neoplasm Metastasis	Associate	18075302, 23374223, 25887589, 32580247
Neoplasm Metastasis	Stimulate	26163388
Neoplasm Residual	Associate	26872634
Neoplasms	Associate	15548358, 15846297, 16101197, 16294026, 16373964, 16565971, 17229632, 17695499, 17896786, 18075302, 18515258, 18670317, 18794102, 19035305, 19182535 View all (81 more)
Neoplasms	Stimulate	22865780, 23401071, 23785399
Neoplasms	Inhibit	23633104, 28427224
Neoplasms Germ Cell and Embryonal	Associate	25085632
Neoplasms Glandular and Epithelial	Associate	19846951
Neuroblastoma	Associate	19952113, 25264277, 28471683
Neuroectodermal Tumors Primitive	Associate	24559248
Neuroendocrine Tumors	Associate	23676460
Neuroendocrine Tumors	Stimulate	29149451
Neurofibromatosis 2	Associate	28427224
Neurofibrosarcoma	Associate	17558420, 19246520
Neuroinflammatory Diseases	Associate	37137722
Nijmegen Breakage Syndrome	Associate	28183292
Oligodendroglioma	Associate	20889717
Osteoarthritis	Associate	25807424
Osteoarthropathy Primary Hypertrophic	Associate	7756654
Osteogenesis Imperfecta	Associate	21596750
Osteolysis Essential	Associate	17139320
Osteosarcoma	Associate	21751203, 32580247
Ovarian Neoplasms	Associate	12910520, 18075302, 18465140, 27931046, 33731124, 38010623
Pancreatic Neoplasms	Associate	22403002, 23950591, 36849201
Papilloma Choroid Plexus	Associate	18157090
Parkinson Disease	Associate	32472394, 39847894
Parkinson Disease Secondary	Associate	29955172
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	18950453, 30697976
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	12542482, 16960151, 17296564
Pediatric Obesity	Associate	30459472
Pemphigus	Associate	37839777
Penttinen Aula syndrome	Associate	26279204, 28726812, 30573803, 33450762, 35689379
Periodontitis	Associate	36389665
Peritoneal Fibrosis	Associate	25376624
Persistent Vegetative State	Associate	35695802
Philadelphia Chromosome	Associate	24628626, 29133777, 29434033, 37196217
Phyllodes Tumor	Associate	27881889
Plaque Atherosclerotic	Associate	17727656
Plasmablastic Lymphoma	Associate	34714908
Pneumonia	Associate	28471683
Pneumonia Aspiration	Associate	18571505, 23656719
Polycystic Kidney Autosomal Recessive	Associate	34686668
Polyposis Syndrome Hereditary Mixed 1	Associate	20358421
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27176795
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22356850, 26872634, 28408464, 28555080, 29133777, 29434033, 38350028
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24628626, 35650277, 35689379
Primary Myelofibrosis	Associate	24810671
Primary Myelofibrosis	Stimulate	7756654
Prostatic Neoplasms	Associate	15548358, 20505768, 28233816
Prostatitis	Associate	18339874, 20505768
Psychotic Disorders	Associate	26279204
Pulmonary Arterial Hypertension	Associate	32634060
Pulmonary Embolism	Associate	31204374
Radiation Injuries	Associate	24512807
Renal Insufficiency Chronic	Associate	18187181
Rhabdomyosarcoma	Associate	17896786
Sarcoma	Associate	30598078, 32567826
Sarcoma Endometrial Stromal	Associate	23221606
Sarcoma Ewing	Associate	17342771
Sarcoma Synovial	Associate	33524869
Schizophrenia	Associate	25211641
Scleroderma Systemic	Associate	17363728, 19180499
Segmentation syndrome 1	Associate	35156398
Simpson Golabi Behmel syndrome	Associate	26279204
Sinonasal undifferentiated carcinoma	Associate	23633104
Skin Diseases	Associate	12181402, 17363728
Skin Ulcer	Associate	12181402
Small Cell Lung Carcinoma	Inhibit	26277786
Soft Tissue Neoplasms	Associate	26085647
Solitary Fibrous Tumors	Associate	18670317, 23833101, 24353015, 26085647, 40660115
Spinal Cord Diseases	Associate	21789698
Splenomegaly	Associate	32386029
Squamous Cell Carcinoma of Head and Neck	Associate	27128408, 32235327
Stomach Neoplasms	Associate	17659711, 20076898, 20354211, 21118571, 24837198, 28975979, 30841447, 32058995, 32908579, 34958001, 35066967, 37100457, 37800754, 37847945, 38228846
Stomach Neoplasms	Stimulate	28423550
Subarachnoid Hemorrhage	Associate	35156398
Thrombocytosis	Associate	21685469
Thymoma	Associate	27844328
Thymus Neoplasms	Associate	26254278
Thyroid Cancer Papillary	Associate	11389034, 19968886, 26715280
Thyroid Neoplasms	Associate	27556512
Triple Negative Breast Neoplasms	Associate	24779793, 29792166, 30777101
Tyrosine Kinase 2 Deficiency	Associate	38252454
Urethral Neoplasms	Associate	26598538
Urinary Bladder Neoplasms	Associate	26225770, 31937798
Uveitis	Associate	26848019
Uveitis Posterior	Associate	26848019
Vaginitis	Associate	30718536
Vision Low	Associate	30573803
Vitiligo	Associate	20169295
Vitreoretinopathy Proliferative	Associate	19032953, 37537538
von Hippel Lindau Disease	Stimulate	29149451, 35637958

PDGFRB (platelet derived growth factor receptor beta)