Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51588
Gene name	Protein inhibitor of activated STAT 4
Gene symbol	PIAS4
Synonyms (NCBI Gene)	PIAS-gammaPIASYPiasgZMIZ6
Chromosome	19
Chromosome location	19p13.3

132

Show/Hide all (132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043227	hsa-miR-324-5p	CLASH	23622248
MIRT719599	hsa-miR-1203	HITS-CLIP	19536157
MIRT719598	hsa-miR-5090	HITS-CLIP	19536157
MIRT719597	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT501631	hsa-miR-3960	HITS-CLIP	19536157
MIRT501630	hsa-miR-8072	HITS-CLIP	19536157
MIRT719596	hsa-miR-4767	HITS-CLIP	19536157
MIRT719595	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT501629	hsa-miR-4467	HITS-CLIP	19536157
MIRT719594	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT719593	hsa-miR-663a	HITS-CLIP	19536157
MIRT719592	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT719599	hsa-miR-1203	HITS-CLIP	19536157
MIRT719598	hsa-miR-5090	HITS-CLIP	19536157
MIRT719597	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT501631	hsa-miR-3960	HITS-CLIP	19536157
MIRT501630	hsa-miR-8072	HITS-CLIP	19536157
MIRT719596	hsa-miR-4767	HITS-CLIP	19536157
MIRT719595	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT501629	hsa-miR-4467	HITS-CLIP	19536157
MIRT719594	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT719593	hsa-miR-663a	HITS-CLIP	19536157
MIRT719592	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT639988	hsa-miR-135b-5p	HITS-CLIP	23824327
MIRT639987	hsa-miR-135a-5p	HITS-CLIP	23824327
MIRT639986	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT639985	hsa-miR-7108-3p	HITS-CLIP	23824327
MIRT639984	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT639983	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT639982	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT639981	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT501637	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT501636	hsa-miR-4707-3p	PAR-CLIP	20371350
MIRT501635	hsa-miR-4632-3p	PAR-CLIP	20371350
MIRT501634	hsa-miR-604	PAR-CLIP	20371350
MIRT501632	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT501637	hsa-miR-4758-3p	PAR-CLIP	24398324
MIRT501636	hsa-miR-4707-3p	PAR-CLIP	24398324
MIRT501635	hsa-miR-4632-3p	PAR-CLIP	24398324
MIRT501634	hsa-miR-604	PAR-CLIP	24398324
MIRT501632	hsa-miR-6829-5p	PAR-CLIP	24398324
MIRT501633	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT501631	hsa-miR-3960	PAR-CLIP	24398324
MIRT501630	hsa-miR-8072	PAR-CLIP	24398324
MIRT501629	hsa-miR-4467	PAR-CLIP	24398324
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	24398324
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501631	hsa-miR-3960	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501629	hsa-miR-4467	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT501630	hsa-miR-8072	PAR-CLIP	26701625
MIRT719599	hsa-miR-1203	HITS-CLIP	19536157
MIRT719598	hsa-miR-5090	HITS-CLIP	19536157
MIRT719597	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT501631	hsa-miR-3960	HITS-CLIP	19536157
MIRT501630	hsa-miR-8072	HITS-CLIP	19536157
MIRT719596	hsa-miR-4767	HITS-CLIP	19536157
MIRT719595	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT501629	hsa-miR-4467	HITS-CLIP	19536157
MIRT719594	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT719593	hsa-miR-663a	HITS-CLIP	19536157
MIRT719592	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT719599	hsa-miR-1203	HITS-CLIP	19536157
MIRT719598	hsa-miR-5090	HITS-CLIP	19536157
MIRT719597	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT501631	hsa-miR-3960	HITS-CLIP	19536157
MIRT501630	hsa-miR-8072	HITS-CLIP	19536157
MIRT719596	hsa-miR-4767	HITS-CLIP	19536157
MIRT719595	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT501629	hsa-miR-4467	HITS-CLIP	19536157
MIRT719594	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT719593	hsa-miR-663a	HITS-CLIP	19536157
MIRT719592	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT639988	hsa-miR-135b-5p	HITS-CLIP	23824327
MIRT639987	hsa-miR-135a-5p	HITS-CLIP	23824327
MIRT639986	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT639985	hsa-miR-7108-3p	HITS-CLIP	23824327
MIRT639984	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT639983	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT639982	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT639981	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT501637	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT501636	hsa-miR-4707-3p	PAR-CLIP	20371350
MIRT501635	hsa-miR-4632-3p	PAR-CLIP	20371350
MIRT501634	hsa-miR-604	PAR-CLIP	20371350
MIRT501632	hsa-miR-6829-5p	PAR-CLIP	20371350
MIRT501637	hsa-miR-4758-3p	PAR-CLIP	24398324
MIRT501636	hsa-miR-4707-3p	PAR-CLIP	24398324
MIRT501635	hsa-miR-4632-3p	PAR-CLIP	24398324
MIRT501634	hsa-miR-604	PAR-CLIP	24398324
MIRT501632	hsa-miR-6829-5p	PAR-CLIP	24398324
MIRT501633	hsa-miR-185-3p	PAR-CLIP	24398324
MIRT501631	hsa-miR-3960	PAR-CLIP	24398324
MIRT501630	hsa-miR-8072	PAR-CLIP	24398324
MIRT501629	hsa-miR-4467	PAR-CLIP	24398324
MIRT501628	hsa-miR-6770-3p	PAR-CLIP	24398324
MIRT1232953	hsa-miR-29a	CLIP-seq
MIRT1232954	hsa-miR-29b	CLIP-seq
MIRT1232955	hsa-miR-29c	CLIP-seq
MIRT1232956	hsa-miR-3663-3p	CLIP-seq
MIRT1232957	hsa-miR-4520a-5p	CLIP-seq
MIRT1232958	hsa-miR-4520b-5p	CLIP-seq
MIRT1232959	hsa-miR-4710	CLIP-seq
MIRT1232960	hsa-miR-4733-3p	CLIP-seq
MIRT1232961	hsa-miR-4792	CLIP-seq
MIRT2295681	hsa-miR-198	CLIP-seq
MIRT2295682	hsa-miR-4257	CLIP-seq
MIRT2295683	hsa-miR-520a-5p	CLIP-seq
MIRT2295684	hsa-miR-525-5p	CLIP-seq
MIRT2295685	hsa-miR-552	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0001942	Process	Hair follicle development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	11388671, 15383276, 17606919, 17696781, 18063693, 19779455, 20661221, 21965678, 21988832, 28842558, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	11248056, 16816390
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9724754
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16816390
GO:0006302	Process	Double-strand break repair	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IDA	35013556
GO:0007417	Process	Central nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9724754
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	18579533
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IMP	22508508
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	11731474, 19041634, 21965678
GO:0019789	Function	SUMO transferase activity	IEA
GO:0019789	Function	SUMO transferase activity	IMP	22508508
GO:0019789	Function	SUMO transferase activity	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16816390
GO:0033235	Process	Positive regulation of protein sumoylation	IDA	17696781, 21965678
GO:0042359	Process	Vitamin D metabolic process	TAS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043488	Process	Regulation of mRNA stability	IDA	34048572
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11248056
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	9724754
GO:0046872	Function	Metal ion binding	IEA
GO:0060887	Process	Limb epidermis development	IEA
GO:0061157	Process	MRNA destabilization	IDA	34048572
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061665	Function	SUMO ligase activity	IBA
GO:0061665	Function	SUMO ligase activity	IDA	18579533, 32832608, 34048572, 35013556
GO:0061665	Function	SUMO ligase activity	IEA
GO:0080135	Process	Regulation of cellular response to stress	IEA
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	35013556
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	35013556
GO:1902174	Process	Positive regulation of keratinocyte apoptotic process	IEA
GO:1902174	Process	Positive regulation of keratinocyte apoptotic process	ISS
GO:1902231	Process	Positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	32832608
GO:1990234	Component	Transferase complex	IEA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	32832608

MIM	HGNC	e!Ensembl
605989	17002	ENSG00000105229

Q8N2W9

Protein name

E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma)

Protein function

Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor (PubMed:12511558, PubMed:12631292, PubMed:12727872, PubMed:15831457, PubMed:15976810

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14324	PINIT	130 → 277	PINIT domain	Domain
PF02891	zf-MIZ	322 → 371	MIZ/SP-RING zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:11439351}.

Sequence

MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC

Sequence length

510

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Ubiquitin mediated proteolysis JAK-STAT signaling pathway Fluid shear stress and atherosclerosis		Vitamin D (calciferol) metabolism SUMOylation of DNA damage response and repair proteins SUMOylation of transcription factors SUMOylation of ubiquitinylation proteins SUMOylation of transcription cofactors SUMOylation of SUMOylation proteins SUMOylation of intracellular receptors SUMOylation of DNA replication proteins SUMOylation of immune response proteins Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Nonhomologous End-Joining (NHEJ) Processing of DNA double-strand break ends G2/M DNA damage checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PIAS4-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	26616021	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	39245738	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Associate	25853300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	25853300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Herpes Simplex	Associate	26937035	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	20300531, 24002598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	30612578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Associate	25853300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	30612578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development Group I	Associate	28381165	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Associate	25853300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	39245738	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	14531911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16793547	★★★★★ ★☆☆☆☆ Found in Text Mining only
NF1 Microduplication Syndrome	Associate	25853300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24002598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	24002598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	34054823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Associate	26317783	★★★★★ ★☆☆☆☆ Found in Text Mining only

PIAS4 (protein inhibitor of activated STAT 4)