Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51571
Gene name Gene Name - the full gene name approved by the HGNC.	CYFIP related Rac1 interactor B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYRIB
Synonyms (NCBI Gene) Gene synonyms aliases	BM-009, CYRI, CYRI-B, FAM49B, L1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.21

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002576	Process	Platelet degranulation	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005739	Component	Mitochondrion	IDA	29059164
GO:0005929	Component	Cilium	ISS
GO:0016020	Component	Membrane	IEA
GO:0023030	Function	MHC class Ib protein binding, via antigen binding groove	ISS
GO:0030334	Process	Regulation of cell migration	IMP	30250061
GO:0030837	Process	Negative regulation of actin filament polymerization	IMP	30250061
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031267	Function	Small GTPase binding	IPI	30250061, 31285585
GO:0032729	Process	Positive regulation of interferon-gamma production	ISS
GO:0050870	Process	Positive regulation of T cell activation	IBA	21873635
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0050920	Process	Regulation of chemotaxis	IMP	30250061
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IMP	30250061, 31285585
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0071219	Process	Cellular response to molecule of bacterial origin	IMP	31285585
GO:0090140	Process	Regulation of mitochondrial fission	IMP	29059164
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	30250061
GO:2000568	Process	Positive regulation of memory T cell activation	ISS

MIM	HGNC	e!Ensembl
617978	25216	ENSG00000153310

Protein

UniProt ID

Q9NUQ9

Protein name

CYFIP-related Rac1 interactor B (L1)

Protein function

Negatively regulates RAC1 signaling and RAC1-driven cytoskeletal remodeling (PubMed:30250061, PubMed:31285585). Regulates chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of prot

PDB

7AJK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07159	DUF1394	18 → 320	Protein of unknown function (DUF1394)	Family

Sequence

MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAG
HEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQ
HLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVN
NELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTDCLSTMASVCRVMLETPEY
RSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDMKGCIKVLKDQPPNSVEGLL
NALRYTTKHLNDETTSKQIKSMLQ

Sequence length

324

Interactions

View interactions

	KEGG		Reactome
	Regulation of actin cytoskeleton		Platelet degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	30891314

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	References	Source
Unknown
Heart failure	Heart Failure, Diastolic		29556499	ClinVar
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Metabolic Syndrome	Metabolic Syndrome			GWAS
Alzheimer disease	Alzheimer disease			GWAS
Schizophrenia	Schizophrenia			GWAS

CYRIB (CYFIP related Rac1 interactor B)