Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	51564
Gene name	Histone deacetylase 7
Gene symbol	HDAC7
Synonyms (NCBI Gene)	HD7HD7AHDAC7A
Chromosome	12
Chromosome location	12q13.11
Summary	Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene h

129

Show/Hide all (129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045413	hsa-miR-149-5p	CLASH	23622248
MIRT040075	hsa-miR-615-3p	CLASH	23622248
MIRT438365	hsa-miR-140-5p	Luciferase reporter assayWestern blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assayWestern blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assayWestern blot	24530397
MIRT438365	hsa-miR-140-5p	Luciferase reporter assayWestern blot	24530397
MIRT732960	hsa-miR-1260a	ImmunofluorescenceImmunohistochemistry (IHC)RNA-seqqRT-PCRWestern blotting	34256779
MIRT1042526	hsa-miR-3171	CLIP-seq
MIRT1042527	hsa-miR-3663-3p	CLIP-seq
MIRT1042528	hsa-miR-4278	CLIP-seq
MIRT1042529	hsa-miR-4459	CLIP-seq
MIRT1042530	hsa-miR-4685-5p	CLIP-seq
MIRT1042531	hsa-miR-4686	CLIP-seq
MIRT1042532	hsa-miR-4700-3p	CLIP-seq
MIRT1042533	hsa-miR-4716-3p	CLIP-seq
MIRT1042534	hsa-miR-4733-3p	CLIP-seq
MIRT1042535	hsa-miR-4761-3p	CLIP-seq
MIRT1042536	hsa-miR-665	CLIP-seq
MIRT1042537	hsa-miR-767-3p	CLIP-seq
MIRT1042538	hsa-miR-2467-3p	CLIP-seq
MIRT1042539	hsa-miR-3170	CLIP-seq
MIRT1042540	hsa-miR-3678-3p	CLIP-seq
MIRT1042541	hsa-miR-4667-5p	CLIP-seq
MIRT1042542	hsa-miR-4700-5p	CLIP-seq
MIRT1042543	hsa-miR-637	CLIP-seq
MIRT2009002	hsa-miR-1224-3p	CLIP-seq
MIRT2009003	hsa-miR-125a-3p	CLIP-seq
MIRT2009004	hsa-miR-1260	CLIP-seq
MIRT2009005	hsa-miR-1260b	CLIP-seq
MIRT2009006	hsa-miR-1280	CLIP-seq
MIRT2009007	hsa-miR-1307	CLIP-seq
MIRT2009008	hsa-miR-150	CLIP-seq
MIRT2009009	hsa-miR-1910	CLIP-seq
MIRT2009010	hsa-miR-2115	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2009012	hsa-miR-3126-5p	CLIP-seq
MIRT2009013	hsa-miR-3127-3p	CLIP-seq
MIRT1042526	hsa-miR-3171	CLIP-seq
MIRT2009014	hsa-miR-3180-5p	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2009016	hsa-miR-3529	CLIP-seq
MIRT1042527	hsa-miR-3663-3p	CLIP-seq
MIRT2009017	hsa-miR-3665	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2009019	hsa-miR-379	CLIP-seq
MIRT2009020	hsa-miR-3919	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2009022	hsa-miR-4451	CLIP-seq
MIRT1042529	hsa-miR-4459	CLIP-seq
MIRT2009023	hsa-miR-4481	CLIP-seq
MIRT2009024	hsa-miR-4496	CLIP-seq
MIRT2009025	hsa-miR-4638-5p	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2009027	hsa-miR-4650-3p	CLIP-seq
MIRT1042530	hsa-miR-4685-5p	CLIP-seq
MIRT1042531	hsa-miR-4686	CLIP-seq
MIRT1042532	hsa-miR-4700-3p	CLIP-seq
MIRT2009028	hsa-miR-4713-5p	CLIP-seq
MIRT1042534	hsa-miR-4733-3p	CLIP-seq
MIRT2009029	hsa-miR-4742-3p	CLIP-seq
MIRT2009030	hsa-miR-4745-5p	CLIP-seq
MIRT1042535	hsa-miR-4761-3p	CLIP-seq
MIRT2009031	hsa-miR-4768-5p	CLIP-seq
MIRT2009032	hsa-miR-4772-5p	CLIP-seq
MIRT2009033	hsa-miR-520a-5p	CLIP-seq
MIRT2009034	hsa-miR-525-5p	CLIP-seq
MIRT2009035	hsa-miR-532-3p	CLIP-seq
MIRT1042536	hsa-miR-665	CLIP-seq
MIRT1042537	hsa-miR-767-3p	CLIP-seq
MIRT2009036	hsa-miR-767-5p	CLIP-seq
MIRT2009037	hsa-miR-873	CLIP-seq
MIRT2009038	hsa-miR-942	CLIP-seq
MIRT2009009	hsa-miR-1910	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2241369	hsa-miR-4687-3p	CLIP-seq
MIRT2241370	hsa-miR-574-3p	CLIP-seq
MIRT2545034	hsa-miR-1178	CLIP-seq
MIRT2545035	hsa-miR-1202	CLIP-seq
MIRT2545036	hsa-miR-1237	CLIP-seq
MIRT2545037	hsa-miR-1248	CLIP-seq
MIRT2545038	hsa-miR-1254	CLIP-seq
MIRT2009011	hsa-miR-2117	CLIP-seq
MIRT2545039	hsa-miR-3116	CLIP-seq
MIRT2545040	hsa-miR-326	CLIP-seq
MIRT2545041	hsa-miR-330-3p	CLIP-seq
MIRT2545042	hsa-miR-330-5p	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2545043	hsa-miR-3667-5p	CLIP-seq
MIRT2545044	hsa-miR-3675-3p	CLIP-seq
MIRT2545045	hsa-miR-3690	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2545046	hsa-miR-3972	CLIP-seq
MIRT2009021	hsa-miR-4273	CLIP-seq
MIRT2545047	hsa-miR-4488	CLIP-seq
MIRT2545048	hsa-miR-4489	CLIP-seq
MIRT2545049	hsa-miR-4509	CLIP-seq
MIRT2545050	hsa-miR-4514	CLIP-seq
MIRT2545051	hsa-miR-4635	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2545052	hsa-miR-4650-5p	CLIP-seq
MIRT2241369	hsa-miR-4687-3p	CLIP-seq
MIRT2545053	hsa-miR-4690-5p	CLIP-seq
MIRT2545054	hsa-miR-4692	CLIP-seq
MIRT2545055	hsa-miR-4697-5p	CLIP-seq
MIRT2545056	hsa-miR-4709-3p	CLIP-seq
MIRT2545057	hsa-miR-4744	CLIP-seq
MIRT2545058	hsa-miR-4755-3p	CLIP-seq
MIRT2545059	hsa-miR-526b	CLIP-seq
MIRT2545060	hsa-miR-548u	CLIP-seq
MIRT2545061	hsa-miR-606	CLIP-seq
MIRT2545062	hsa-miR-711	CLIP-seq
MIRT2545063	hsa-miR-940	CLIP-seq
MIRT2545034	hsa-miR-1178	CLIP-seq
MIRT2545035	hsa-miR-1202	CLIP-seq
MIRT2545036	hsa-miR-1237	CLIP-seq
MIRT2545037	hsa-miR-1248	CLIP-seq
MIRT2545038	hsa-miR-1254	CLIP-seq
MIRT2545039	hsa-miR-3116	CLIP-seq
MIRT2009015	hsa-miR-342-3p	CLIP-seq
MIRT2545045	hsa-miR-3690	CLIP-seq
MIRT2009018	hsa-miR-377	CLIP-seq
MIRT2545046	hsa-miR-3972	CLIP-seq
MIRT2545051	hsa-miR-4635	CLIP-seq
MIRT2009026	hsa-miR-4643	CLIP-seq
MIRT2545052	hsa-miR-4650-5p	CLIP-seq
MIRT2545056	hsa-miR-4709-3p	CLIP-seq
MIRT2545059	hsa-miR-526b	CLIP-seq
MIRT2545062	hsa-miR-711	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
BCL6	Repression	11929873
MEF2D	Unknown	15171250
NFKB1	Unknown	21243522
RELA	Unknown	21243522

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	ISS
GO:0005080	Function	Protein kinase C binding	IPI	20188095
GO:0005515	Function	Protein binding	IPI	15161933, 15194749, 15778465, 17360565, 17962809, 18339811, 20224040, 22155184, 23565059, 23752268, 24658140, 25416956, 28514442, 31980649, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	16980613, 17997710
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16980613, 17997710
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006476	Process	Protein deacetylation	IMP	30538141
GO:0007043	Process	Cell-cell junction assembly	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	TAS
GO:0019901	Function	Protein kinase binding	IPI	16980613
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	17360565
GO:0033558	Function	Protein lysine deacetylase activity	IDA	30538141, 37369679
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IBA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IMP	17997710
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050684	Process	Regulation of mRNA processing	IDA	37369679
GO:0071889	Function	14-3-3 protein binding	IDA	16980613
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	19351956
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	17360565, 20590529
GO:0140694	Process	Membraneless organelle assembly	IDA	37474102
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	25411248

MIM	HGNC	e!Ensembl
606542	14067	ENSG00000061273

Q8WUI4

Protein name

Histone deacetylase 7 (HD7) (EC 3.5.1.98) (Histone deacetylase 7A) (HD7a) (Protein deacetylase HDAC7) (EC 3.5.1.-)

Protein function

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (By similarity). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional re

PDB

3C0Y , 3C0Z , 3C10 , 3ZNR , 3ZNS , 8Q9Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00850	Hist_deacetyl	541 → 859	Histone deacetylase domain	Domain

Sequence

MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPL
ETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL

Sequence length

952

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Alcoholism Viral carcinogenesis		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants SUMOylation of DNA damage response and repair proteins Notch-HLH transcription pathway

HDAC7 (histone deacetylase 7)