Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51562
Gene name	MAP3K12 binding inhibitory protein 1
Gene symbol	MBIP
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q13.3

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029808	hsa-miR-26b-5p	Microarray	19088304
MIRT048560	hsa-miR-100-5p	CLASH	23622248
MIRT1135181	hsa-miR-1255a	CLIP-seq
MIRT1135182	hsa-miR-1255b	CLIP-seq
MIRT1135183	hsa-miR-1287	CLIP-seq
MIRT1135184	hsa-miR-1305	CLIP-seq
MIRT1135185	hsa-miR-132	CLIP-seq
MIRT1135186	hsa-miR-200b	CLIP-seq
MIRT1135187	hsa-miR-200c	CLIP-seq
MIRT1135188	hsa-miR-212	CLIP-seq
MIRT1135189	hsa-miR-2276	CLIP-seq
MIRT1135190	hsa-miR-27a	CLIP-seq
MIRT1135191	hsa-miR-27b	CLIP-seq
MIRT1135192	hsa-miR-300	CLIP-seq
MIRT1135193	hsa-miR-320a	CLIP-seq
MIRT1135194	hsa-miR-320b	CLIP-seq
MIRT1135195	hsa-miR-320c	CLIP-seq
MIRT1135196	hsa-miR-320d	CLIP-seq
MIRT1135197	hsa-miR-320e	CLIP-seq
MIRT1135198	hsa-miR-3607-5p	CLIP-seq
MIRT1135199	hsa-miR-3613-3p	CLIP-seq
MIRT1135200	hsa-miR-3647-3p	CLIP-seq
MIRT1135201	hsa-miR-3662	CLIP-seq
MIRT1135202	hsa-miR-378	CLIP-seq
MIRT1135203	hsa-miR-378b	CLIP-seq
MIRT1135204	hsa-miR-378c	CLIP-seq
MIRT1135205	hsa-miR-378d	CLIP-seq
MIRT1135206	hsa-miR-378e	CLIP-seq
MIRT1135207	hsa-miR-378f	CLIP-seq
MIRT1135208	hsa-miR-378h	CLIP-seq
MIRT1135209	hsa-miR-378i	CLIP-seq
MIRT1135210	hsa-miR-381	CLIP-seq
MIRT1135211	hsa-miR-3913-3p	CLIP-seq
MIRT1135212	hsa-miR-3919	CLIP-seq
MIRT1135213	hsa-miR-3924	CLIP-seq
MIRT1135214	hsa-miR-3941	CLIP-seq
MIRT1135215	hsa-miR-422a	CLIP-seq
MIRT1135216	hsa-miR-429	CLIP-seq
MIRT1135217	hsa-miR-4429	CLIP-seq
MIRT1135218	hsa-miR-4643	CLIP-seq
MIRT1135219	hsa-miR-466	CLIP-seq
MIRT1135220	hsa-miR-4666-3p	CLIP-seq
MIRT1135221	hsa-miR-4666-5p	CLIP-seq
MIRT1135222	hsa-miR-4672	CLIP-seq
MIRT1135223	hsa-miR-4699-3p	CLIP-seq
MIRT1135224	hsa-miR-4712-3p	CLIP-seq
MIRT1135225	hsa-miR-4789-3p	CLIP-seq
MIRT1135226	hsa-miR-489	CLIP-seq
MIRT1135227	hsa-miR-513a-5p	CLIP-seq
MIRT1135228	hsa-miR-548a-5p	CLIP-seq
MIRT1135229	hsa-miR-548ab	CLIP-seq
MIRT1135230	hsa-miR-548ak	CLIP-seq
MIRT1135231	hsa-miR-548b-5p	CLIP-seq
MIRT1135232	hsa-miR-548c-5p	CLIP-seq
MIRT1135233	hsa-miR-548d-5p	CLIP-seq
MIRT1135234	hsa-miR-548h	CLIP-seq
MIRT1135235	hsa-miR-548i	CLIP-seq
MIRT1135236	hsa-miR-548j	CLIP-seq
MIRT1135237	hsa-miR-548n	CLIP-seq
MIRT1135238	hsa-miR-548w	CLIP-seq
MIRT1135239	hsa-miR-548y	CLIP-seq
MIRT1135240	hsa-miR-559	CLIP-seq
MIRT1135241	hsa-miR-586	CLIP-seq
MIRT1135242	hsa-miR-617	CLIP-seq
MIRT1135184	hsa-miR-1305	CLIP-seq
MIRT2268279	hsa-miR-4282	CLIP-seq
MIRT2268280	hsa-miR-4704-3p	CLIP-seq
MIRT2268281	hsa-miR-4760-3p	CLIP-seq
MIRT2268282	hsa-miR-513a-3p	CLIP-seq
MIRT2268283	hsa-miR-548k	CLIP-seq
MIRT2268284	hsa-miR-579	CLIP-seq
MIRT2268285	hsa-miR-664	CLIP-seq
MIRT2567920	hsa-miR-1278	CLIP-seq
MIRT2567921	hsa-miR-3129-3p	CLIP-seq
MIRT2567922	hsa-miR-3653	CLIP-seq
MIRT2567923	hsa-miR-3658	CLIP-seq
MIRT1135211	hsa-miR-3913-3p	CLIP-seq
MIRT2567924	hsa-miR-3973	CLIP-seq
MIRT2268279	hsa-miR-4282	CLIP-seq
MIRT1135218	hsa-miR-4643	CLIP-seq
MIRT1135219	hsa-miR-466	CLIP-seq
MIRT2268280	hsa-miR-4704-3p	CLIP-seq
MIRT2268281	hsa-miR-4760-3p	CLIP-seq
MIRT1135225	hsa-miR-4789-3p	CLIP-seq
MIRT2567925	hsa-miR-4795-3p	CLIP-seq
MIRT2567926	hsa-miR-485-3p	CLIP-seq
MIRT1135226	hsa-miR-489	CLIP-seq
MIRT2268282	hsa-miR-513a-3p	CLIP-seq
MIRT2567927	hsa-miR-518a-5p	CLIP-seq
MIRT2567928	hsa-miR-527	CLIP-seq
MIRT2567929	hsa-miR-548g	CLIP-seq
MIRT2268283	hsa-miR-548k	CLIP-seq
MIRT2268284	hsa-miR-579	CLIP-seq
MIRT2567930	hsa-miR-582-3p	CLIP-seq
MIRT1135241	hsa-miR-586	CLIP-seq
MIRT2567931	hsa-miR-653	CLIP-seq
MIRT2268285	hsa-miR-664	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18838386
GO:0004860	Function	Protein kinase inhibitor activity	IDA	10801814
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 24981860, 25416956, 25910212, 26871637, 27705803, 27956147, 28514442, 31515488, 32296183, 32814053, 33961781, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	19936620
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	22055187
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0010628	Process	Positive regulation of gene expression	IDA	32963352
GO:0042802	Function	Identical protein binding	IPI	16189514, 19060904
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IDA	10801814, 32963352
GO:0051302	Process	Regulation of cell division	IDA	20562830
GO:0051302	Process	Regulation of cell division	IEA
GO:0051302	Process	Regulation of cell division	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	19103755
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0072686	Component	Mitotic spindle	NAS	20562830
GO:0140672	Component	ATAC complex	IDA	18838386, 19936620
GO:0140672	Component	ATAC complex	IEA
GO:0140672	Component	ATAC complex	ISO

MIM	HGNC	e!Ensembl
609431	20427	ENSG00000151332

Q9NS73

Protein name

MAP3K12-binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein)

Protein function

Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. High expression seen in the heart and lung.

Sequence

MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKL
QSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFS
IGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR
EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP

Sequence length

344

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	24805830, 32711446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	23357979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorea	Associate	29621620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	29621620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23357979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	27342578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	33903625	★★★★★ ★☆☆☆☆ Found in Text Mining only

MBIP (MAP3K12 binding inhibitory protein 1)