Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51561
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 23 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL23A
Synonyms (NCBI Gene) Gene synonyms aliases	IL-23, IL-23A, IL23P19, P19, SGRF
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific su

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
CEBPD	Activation	23028973
E2F1	Unknown	17707233
JUN	Unknown	17569750;22904313
NFKB1	Activation	17569750
NFKB1	Unknown	17707233
RELA	Activation	17569750
RELA	Unknown	17707233

Show/Hide all(68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IBA
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IBA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	NAS	20027291
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	TAS	16751425
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	11114383, 12023369, 18680750, 25416956, 29997244, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	12023369
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11114383, 17888176, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	TAS	19088061
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	11114383
GO:0043382	Process	Positive regulation of memory T cell differentiation	IEA
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045519	Function	Interleukin-23 receptor binding	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046635	Process	Positive regulation of alpha-beta T cell activation	IEA
GO:0048771	Process	Tissue remodeling	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IBA
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0070743	Component	Interleukin-23 complex	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	19088061
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	TAS	20428758
GO:1902107	Process	Positive regulation of leukocyte differentiation	IEA
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	IEA
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	IBA
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	IEA
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

MIM	HGNC	e!Ensembl
605580	15488	ENSG00000110944

Protein

UniProt ID

Q9NPF7

Protein name

Interleukin-23 subunit alpha (IL-23 subunit alpha) (IL-23-A) (Interleukin-23 subunit p19) (IL-23p19)

Protein function

Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity (PubMed:11114383). Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric

PDB

3D85 , 3D87 , 3DUH , 3QWR , 4GRW , 5MJ3 , 5MJ4 , 5MXA , 5MZV , 5NJD , 6UIB , 6WDQ , 8CR8 , 8OE4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16649	IL23	28 → 184	Interleukin 23 subunit alpha	Domain

Tissue specificity

TISSUE SPECIFICITY: Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). {ECO:0000269|PubMed:11114383, ECO:0000269|PubMed:16424222}.

Sequence

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP

Sequence length

189

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction C-type lectin receptor signaling pathway JAK-STAT signaling pathway Th17 cell differentiation Pertussis Tuberculosis Pathways in cancer Inflammatory bowel disease Rheumatoid arthritis		Interleukin-4 and Interleukin-13 signaling Interleukin-23 signaling

IL23A (interleukin 23 subunit alpha)