CINP (cyclin dependent kinase 2 interacting protein)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51550
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin dependent kinase 2 interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CINP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs1060499740 A>C Likely-pathogenic Stop lost, terminator codon variant, 3 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(166)
miRTarBase ID miRNA Experiments Reference
MIRT629245 hsa-miR-130a-3p HITS-CLIP 23824327
MIRT629244 hsa-miR-130b-3p HITS-CLIP 23824327
MIRT629243 hsa-miR-301a-3p HITS-CLIP 23824327
MIRT629242 hsa-miR-301b-3p HITS-CLIP 23824327
MIRT629241 hsa-miR-3666 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19889979, 21131973, 25416956, 28514442, 31515488, 32296183
GO:0005634 Component Nucleus IEA
GO:0006260 Process DNA replication IEA
GO:0006281 Process DNA repair IEA
GO:0007049 Process Cell cycle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613362 23789 ENSG00000100865
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BW66
Protein name Cyclin-dependent kinase 2-interacting protein (CDK2-interacting protein)
Protein function Component of the DNA replication complex, which interacts with two kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication (PubMed:16082200, PubMed:19889979). Reg
PDB 8CIH , 8RHN
Family and domains
Sequence 
MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLN
KDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGIC
ELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTL
SYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Sequence length 212
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Small Cell Lung Carcinoma Associate 37987107