Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51548
Gene name Gene Name - the full gene name approved by the HGNC.	Sirtuin 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SIRT6
Synonyms (NCBI Gene) Gene synonyms aliases	SIR2L6, hSIRT6
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT735225	hsa-miR-186-5p	Western blotting, qRT-PCR	32573339
MIRT1350318	hsa-miR-1224-5p	CLIP-seq
MIRT1350319	hsa-miR-3180-5p	CLIP-seq
MIRT1350320	hsa-miR-33a	CLIP-seq
MIRT1350321	hsa-miR-33b	CLIP-seq
MIRT1350322	hsa-miR-3915	CLIP-seq
MIRT1350323	hsa-miR-4689	CLIP-seq
MIRT1350324	hsa-miR-4751	CLIP-seq
MIRT1350325	hsa-miR-520a-5p	CLIP-seq
MIRT1350326	hsa-miR-525-5p	CLIP-seq
MIRT1350327	hsa-miR-1321	CLIP-seq
MIRT1350328	hsa-miR-1915	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350331	hsa-miR-4270	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT1350333	hsa-miR-4441	CLIP-seq
MIRT1350334	hsa-miR-4739	CLIP-seq
MIRT1350335	hsa-miR-4756-5p	CLIP-seq
MIRT2103776	hsa-miR-130a	CLIP-seq
MIRT2103777	hsa-miR-130b	CLIP-seq
MIRT2103778	hsa-miR-148a	CLIP-seq
MIRT2103779	hsa-miR-148b	CLIP-seq
MIRT2103780	hsa-miR-152	CLIP-seq
MIRT2103781	hsa-miR-2682	CLIP-seq
MIRT2103782	hsa-miR-301a	CLIP-seq
MIRT2103783	hsa-miR-301b	CLIP-seq
MIRT2103784	hsa-miR-34a	CLIP-seq
MIRT2103785	hsa-miR-34c-5p	CLIP-seq
MIRT2103786	hsa-miR-3666	CLIP-seq
MIRT2103787	hsa-miR-3714	CLIP-seq
MIRT2103788	hsa-miR-4295	CLIP-seq
MIRT2103789	hsa-miR-449a	CLIP-seq
MIRT2103790	hsa-miR-449b	CLIP-seq
MIRT2103791	hsa-miR-449c	CLIP-seq
MIRT2103792	hsa-miR-454	CLIP-seq
MIRT2103793	hsa-miR-548an	CLIP-seq
MIRT2622898	hsa-miR-326	CLIP-seq
MIRT2622899	hsa-miR-330-5p	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT2622900	hsa-miR-342-5p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT2622901	hsa-miR-4455	CLIP-seq
MIRT2622902	hsa-miR-4474-3p	CLIP-seq
MIRT2622903	hsa-miR-4651	CLIP-seq
MIRT2622904	hsa-miR-4664-5p	CLIP-seq
MIRT2622905	hsa-miR-4667-5p	CLIP-seq
MIRT2622906	hsa-miR-4700-5p	CLIP-seq
MIRT2622907	hsa-miR-4778-3p	CLIP-seq
MIRT2622908	hsa-miR-608	CLIP-seq
MIRT2622909	hsa-miR-637	CLIP-seq
MIRT2622910	hsa-miR-644	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
FOXO3	Activation	20816089

Show/Hide all(167)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24043303
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	23892288, 27043296, 27912097, 30374165, 33067423
GO:0000785	Component	Chromatin	IDA	26456828
GO:0000785	Component	Chromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	33067423
GO:0003682	Function	Chromatin binding	IDA	27043296, 27912097
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	IMP	33067423
GO:0003684	Function	Damaged DNA binding	IDA	31995034, 32538779
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0005515	Function	Protein binding	IPI	19135889, 23217706, 23911928
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26898756, 29555651
GO:0005634	Component	Nucleus	IDA	25819580, 26456828
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	27043296
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005783	Component	Endoplasmic reticulum	IDA	23552949
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006094	Process	Gluconeogenesis	IDA	16753578
GO:0006096	Process	Glycolytic process	IDA	20847263
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006302	Process	Double-strand break repair	IDA	28190768, 32028527
GO:0006302	Process	Double-strand break repair	IDA	21680843, 27568560
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	23892288
GO:0006338	Process	Chromatin remodeling	IDA	23892288, 33067423, 37023208
GO:0006476	Process	Protein deacetylation	IMP	27457971
GO:0006606	Process	Protein import into nucleus	IDA	20117128
GO:0006606	Process	Protein import into nucleus	IMP	20117128
GO:0006954	Process	Inflammatory response	IDA	21147091, 22267480
GO:0006974	Process	DNA damage response	IEA
GO:0007265	Process	Ras protein signal transduction	IDA	31130282
GO:0008270	Function	Zinc ion binding	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008340	Process	Determination of adult lifespan	IMP	25541994
GO:0009411	Process	Response to UV	IDA	19109893
GO:0010526	Process	Transposable element silencing	IEA
GO:0010526	Process	Transposable element silencing	ISS
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	19135889, 22753495
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	24043303, 27912097
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	ISS
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030234	Function	Enzyme regulator activity	IDA	32538779
GO:0031490	Function	Chromatin DNA binding	IDA	33067423
GO:0031491	Function	Nucleosome binding	IDA	23892288, 33067423
GO:0031491	Function	Nucleosome binding	IMP	33067423
GO:0031508	Process	Pericentric heterochromatin formation	IDA	27043296
GO:0031509	Process	Subtelomeric heterochromatin formation	IMP	21847107
GO:0031648	Process	Protein destabilization	IDA	29474172
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	29474172
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032129	Function	Histone H3K9 deacetylase activity, hydrolytic mechanism	EXP	33067423
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	23201774, 25819580
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	27457971
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	19109893, 23142079, 24052263, 25009184, 26787900, 27322069, 29474172
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0035033	Function	Histone deacetylase regulator activity	IDA	31995034, 32538779
GO:0035861	Component	Site of double-strand break	IDA	21680843, 23911928, 27568560, 31995034, 32538779
GO:0042181	Process	Ketone biosynthetic process	IEA
GO:0042181	Process	Ketone biosynthetic process	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042308	Process	Negative regulation of protein import into nucleus	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	31995034, 32538779
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	16753578
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	23142079, 25009184
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	17024043
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	21847107
GO:0045820	Process	Negative regulation of glycolytic process	IDA	26456828
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22901803, 24120661
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	25009184, 26787900
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IBA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IDA	18337721, 23892288, 26456828, 30374165, 33067423
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IMP	29555651
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0050708	Process	Regulation of protein secretion	IDA	23552949
GO:0050994	Process	Regulation of lipid catabolic process	IEA
GO:0050994	Process	Regulation of lipid catabolic process	ISS
GO:0051697	Process	Protein delipidation	IDA	23552949
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	ISS
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0070403	Function	NAD+ binding	IEA
GO:0070403	Function	NAD+ binding	ISS
GO:0090734	Component	Site of DNA damage	IDA	19109893
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IDA	27043296
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IEA
GO:0099115	Component	Chromosome, subtelomeric region	IDA	18337721
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	IEA
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28723567
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	27912097
GO:0120187	Process	Positive regulation of protein localization to chromatin	IEA
GO:0120187	Process	Positive regulation of protein localization to chromatin	ISS
GO:0140612	Function	DNA damage sensor activity	IDA	31995034, 32538779
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IDA	23911928, 26456828, 26898756, 27912097, 30374165
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IEA
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IDA	23552949, 24052263, 26456828, 27322069, 30374165, 31995034
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IDA	23552949, 24052263, 27322069, 28406396
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IMP	29555651
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IEA
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	14701750
GO:1902459	Process	Positive regulation of stem cell population maintenance	IDA	27912097
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IMP	25819580
GO:1903076	Process	Regulation of protein localization to plasma membrane	IDA	28406396
GO:1904841	Function	TORC2 complex binding	IEA
GO:1904841	Function	TORC2 complex binding	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IMP	23201774
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	23201774
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	21680843, 22753495, 27322069, 27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS
GO:2000773	Process	Negative regulation of cellular senescence	IDA	22753495, 27043296
GO:2000773	Process	Negative regulation of cellular senescence	IMP	29474172
GO:2000774	Process	Positive regulation of cellular senescence	IDA	29474172
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	23911928, 31995034, 32538779
GO:2000781	Process	Positive regulation of double-strand break repair	IEA

MIM	HGNC	e!Ensembl
606211	14934	ENSG00000077463

Protein

UniProt ID

Q8N6T7

Protein name

NAD-dependent protein deacylase sirtuin-6 (EC 2.3.1.-) (NAD-dependent protein deacetylase sirtuin-6) (EC 2.3.1.286) (Protein mono-ADP-ribosyltransferase sirtuin-6) (EC 2.4.2.-) (Regulatory protein SIR2 homolog 6) (hSIRT6) (SIR2-like protein 6)

Protein function

NAD-dependent protein deacetylase, deacylase and mono-ADP-ribosyltransferase that plays an essential role in DNA damage repair, telomere maintenance, metabolic homeostasis, inflammation, tumorigenesis and aging (PubMed:18337721, PubMed:19135889,

PDB

3K35 , 3PKI , 3PKJ , 3ZG6 , 5MF6 , 5MFP , 5MFZ , 5MGN , 5X16 , 5Y2F , 6HOY , 6QCD , 6QCE , 6QCH , 6QCJ , 6XUY , 6XV1 , 6XV6 , 6XVG , 6ZU4 , 7CL0 , 7CL1 , 8AK5 , 8AK6 , 8AK7 , 8AK8 , 8AK9 , 8AKA , 8AKB , 8AKC , 8AKD , 8AKE , 8AKF , 8AKG , 8BL0 , 8BL1 , 8CNM , 8CNO , 8F86 , 8G57 , 8I2B , 8OF4 , 9G7H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	52 → 87	Sir2 family	Family
PF02146	SIR2	81 → 221	Sir2 family	Family

Sequence

MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

Sequence length

355

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Thermogenesis Central carbon metabolism in cancer		Processing of DNA double-strand break ends

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (101)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	31128573
Aging Premature	Associate	18337721, 35811457
Alzheimer Disease	Inhibit	33910019
Aortic Valve Calcification of	Inhibit	38365109
Arthritis Psoriatic	Associate	27496874
Atherosclerosis	Associate	28296196, 33952798, 36733404
Bone Diseases	Associate	31701920
Breast Neoplasms	Associate	25808624, 27746184, 32681437, 35840633
Carcinogenesis	Associate	23800187, 26675349, 35840633, 37566546
Carcinoma Basal Cell	Associate	26631040
Carcinoma Hepatocellular	Associate	30542728, 31257493, 31842909, 36124029, 36308411, 36534275, 37715252, 37763801
Carcinoma Non Small Cell Lung	Inhibit	25197348, 29363378
Carcinoma Non Small Cell Lung	Associate	25227832, 25713071, 27777384, 28443459, 37566546
Carcinoma Pancreatic Ductal	Associate	26121130
Carcinoma Renal Cell	Stimulate	37096064
Cardiovascular Diseases	Associate	28296196
Carotid Stenosis	Associate	22087257
Carotid Stenosis	Stimulate	22087257
Chromosome Breakage	Associate	31995034
Colitis Ulcerative	Associate	33634990
Colorectal Neoplasms	Associate	26657850, 27923994, 30504065, 36807774
Communication Disorders	Associate	36327468
Coronary Artery Disease	Associate	27118880, 35224092
Dental Plaque	Inhibit	34500107
Diabetes Mellitus	Inhibit	34500107
Diabetes Mellitus Type 2	Associate	33096729, 34500107
Diabetic Foot	Associate	33096729
Diabetic Retinopathy	Associate	25162034
Diabetic Retinopathy	Inhibit	38222451
Dyslipidemias	Associate	26332421
Embolism Fat	Associate	30845774
Endometrial Neoplasms	Associate	26183563, 34927546
Endometriosis	Associate	31906251
Esophageal Neoplasms	Associate	28653878
Esophageal Squamous Cell Carcinoma	Stimulate	28653878
Fibrosis	Inhibit	33568575
Fibrosis	Associate	36534275
Fused Teeth	Associate	31995034
Glioma	Inhibit	29659670
Glioma	Associate	31321952
Glucagonoma	Associate	28921546
Granulosa Cell Tumor	Associate	33669567
Head and Neck Neoplasms	Inhibit	29790697
Hematologic Neoplasms	Associate	27766571
HIV Infections	Associate	35209148
Idiopathic Pulmonary Fibrosis	Stimulate	21224216
Inflammation	Associate	23132960, 25162034, 26114387, 29515203, 30845774, 33096729, 33634990, 35811457, 36534275, 36958525
Inflammation	Inhibit	35249460
Insulin Resistance	Associate	36534275
Intervertebral Disc Degeneration	Associate	34531509
Leukemia	Associate	31928132, 32587297
Leukemia Lymphocytic Chronic B Cell	Associate	23108383
Leukemia Myeloid Acute	Associate	27766571, 27864740, 32587297
Liver Diseases	Associate	36534275
Lumbar Stenosis Familial	Associate	33568575
Lung Neoplasms	Associate	25197348, 25713071, 29125477
Lymphatic Metastasis	Stimulate	28653878
Lymphatic Metastasis	Associate	29363378
Melanoma	Inhibit	29215322
Melanoma	Associate	32789493
Metabolic Diseases	Associate	29515203
Mosaic variegated aneuploidy syndrome	Associate	27043296
Multiple Myeloma	Associate	26675349, 30402853
Myopathy with Lactic Acidosis Hereditary	Inhibit	28653878
Myotonic Dystrophy	Inhibit	30845774
Neoplasm Metastasis	Associate	27777384, 29363378, 35686673
Neoplasm Metastasis	Stimulate	31113446, 33282964
Neoplasms	Associate	23800187, 23860128, 25197348, 25816777, 27043296, 27746184, 27777384, 28582846, 29215322, 29515203, 30514106, 34359939, 35840633, 36534275, 37096064
Neoplasms	Inhibit	23982738, 25400728, 25808624, 26183563, 28653878, 28921546, 32789493, 34573442, 35686673, 37566546
Non alcoholic Fatty Liver Disease	Associate	36534275
Non Muscle Invasive Bladder Neoplasms	Associate	25400728
Obesity	Associate	27118880, 35811457
Obesity	Inhibit	30845774
Osteoarthritis	Associate	36496445
Osteoporosis	Associate	31477582, 31701920
Osteosarcoma	Associate	34359939
Ovarian Neoplasms	Inhibit	25807436
Ovarian Neoplasms	Associate	32541517, 35686673
Parkinson Disease	Associate	34021216
Periodontitis	Associate	35249460
Personality Disorders	Associate	32681437
Plaque Atherosclerotic	Associate	22087257
Prostatic Neoplasms	Associate	23982738, 33282964
Prostatitis	Stimulate	23982738
Psoriasis	Associate	27496874
Pulmonary Arterial Hypertension	Associate	33143333
Pulmonary Disease Chronic Obstructive	Inhibit	24367027, 27767101
Sarcoma Kaposi	Inhibit	30651359
Severe Acute Respiratory Syndrome	Associate	33634990
Sleep Apnea Obstructive	Inhibit	31552414
Sleep Deprivation	Associate	35686673
Squamous Cell Carcinoma of Head and Neck	Associate	23475622
Telomeric 22q13 Monosomy Syndrome	Associate	18337721, 25819580
Telomeric 22q13 Monosomy Syndrome	Inhibit	33568575
Thyroid Neoplasms	Inhibit	35136826
Urinary Bladder Neoplasms	Inhibit	25400728
Uterine Cervical Neoplasms	Associate	32066835
Vascular Diseases	Associate	23132960
Vascular Remodeling	Inhibit	23132960
Vascular Ring	Associate	33568575
Werner Syndrome	Associate	18337721

SIRT6 (sirtuin 6)