Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51548
Gene name Gene Name - the full gene name approved by the HGNC.	Sirtuin 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SIRT6
Synonyms (NCBI Gene) Gene synonyms aliases	SIR2L6, hSIRT6
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT735225	hsa-miR-186-5p	Western blotting, qRT-PCR	32573339
MIRT1350318	hsa-miR-1224-5p	CLIP-seq
MIRT1350319	hsa-miR-3180-5p	CLIP-seq
MIRT1350320	hsa-miR-33a	CLIP-seq
MIRT1350321	hsa-miR-33b	CLIP-seq
MIRT1350322	hsa-miR-3915	CLIP-seq
MIRT1350323	hsa-miR-4689	CLIP-seq
MIRT1350324	hsa-miR-4751	CLIP-seq
MIRT1350325	hsa-miR-520a-5p	CLIP-seq
MIRT1350326	hsa-miR-525-5p	CLIP-seq
MIRT1350327	hsa-miR-1321	CLIP-seq
MIRT1350328	hsa-miR-1915	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350331	hsa-miR-4270	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT1350333	hsa-miR-4441	CLIP-seq
MIRT1350334	hsa-miR-4739	CLIP-seq
MIRT1350335	hsa-miR-4756-5p	CLIP-seq
MIRT2103776	hsa-miR-130a	CLIP-seq
MIRT2103777	hsa-miR-130b	CLIP-seq
MIRT2103778	hsa-miR-148a	CLIP-seq
MIRT2103779	hsa-miR-148b	CLIP-seq
MIRT2103780	hsa-miR-152	CLIP-seq
MIRT2103781	hsa-miR-2682	CLIP-seq
MIRT2103782	hsa-miR-301a	CLIP-seq
MIRT2103783	hsa-miR-301b	CLIP-seq
MIRT2103784	hsa-miR-34a	CLIP-seq
MIRT2103785	hsa-miR-34c-5p	CLIP-seq
MIRT2103786	hsa-miR-3666	CLIP-seq
MIRT2103787	hsa-miR-3714	CLIP-seq
MIRT2103788	hsa-miR-4295	CLIP-seq
MIRT2103789	hsa-miR-449a	CLIP-seq
MIRT2103790	hsa-miR-449b	CLIP-seq
MIRT2103791	hsa-miR-449c	CLIP-seq
MIRT2103792	hsa-miR-454	CLIP-seq
MIRT2103793	hsa-miR-548an	CLIP-seq
MIRT2622898	hsa-miR-326	CLIP-seq
MIRT2622899	hsa-miR-330-5p	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT2622900	hsa-miR-342-5p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT2622901	hsa-miR-4455	CLIP-seq
MIRT2622902	hsa-miR-4474-3p	CLIP-seq
MIRT2622903	hsa-miR-4651	CLIP-seq
MIRT2622904	hsa-miR-4664-5p	CLIP-seq
MIRT2622905	hsa-miR-4667-5p	CLIP-seq
MIRT2622906	hsa-miR-4700-5p	CLIP-seq
MIRT2622907	hsa-miR-4778-3p	CLIP-seq
MIRT2622908	hsa-miR-608	CLIP-seq
MIRT2622909	hsa-miR-637	CLIP-seq
MIRT2622910	hsa-miR-644	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
FOXO3	Activation	20816089

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0003247	Process	Post-embryonic cardiac muscle cell growth involved in heart morphogenesis	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	TAS	17456799
GO:0003956	Function	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	ISS
GO:0004407	Function	Histone deacetylase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	19135889, 23217706
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	25819580
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005737	Component	Cytoplasm	IEA
GO:0006471	Process	Protein ADP-ribosylation	ISS
GO:0006471	Process	Protein ADP-ribosylation	TAS	17456799
GO:0006476	Process	Protein deacetylation	IMP	27457971
GO:0008270	Function	Zinc ion binding	ISS
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	19135889
GO:0017136	Function	NAD-dependent histone deacetylase activity	ISS
GO:0019213	Function	Deacetylase activity	IBA	21873635
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031940	Process	Positive regulation of chromatin silencing at telomere	IMP	21847107
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	23201774, 25819580
GO:0034979	Function	NAD-dependent protein deacetylase activity	TAS
GO:0046969	Function	NAD-dependent histone deacetylase activity (H3-K9 specific)	IBA	21873635
GO:0046969	Function	NAD-dependent histone deacetylase activity (H3-K9 specific)	IDA	18337721
GO:0061647	Process	Histone H3-K9 modification	IEA
GO:0070403	Function	NAD+ binding	ISS
GO:0070932	Process	Histone H3 deacetylation	IBA	21873635
GO:0099115	Component	Chromosome, subtelomeric region	IDA	18337721
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28723567
GO:1901485	Process	Positive regulation of transcription factor catabolic process	IMP	27457971
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IMP	25819580
GO:1905549	Process	Positive regulation of subtelomeric heterochromatin assembly	IMP	21847107
GO:1905555	Process	Positive regulation of blood vessel branching	IMP	23201774
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	23201774
GO:1990619	Process	Histone H3-K9 deacetylation	IEA

MIM	HGNC	e!Ensembl
606211	14934	ENSG00000077463

Protein

UniProt ID

Q8N6T7

Protein name

NAD-dependent protein deacylase sirtuin-6 (EC 2.3.1.-) (NAD-dependent protein deacetylase sirtuin-6) (EC 2.3.1.286) (Protein mono-ADP-ribosyltransferase sirtuin-6) (EC 2.4.2.-) (Regulatory protein SIR2 homolog 6) (hSIRT6) (SIR2-like protein 6)

Protein function

NAD-dependent protein deacetylase, deacylase and mono-ADP-ribosyltransferase that plays an essential role in DNA damage repair, telomere maintenance, metabolic homeostasis, inflammation, tumorigenesis and aging (PubMed:18337721, PubMed:19135889,

PDB

3K35 , 3PKI , 3PKJ , 3ZG6 , 5MF6 , 5MFP , 5MFZ , 5MGN , 5X16 , 5Y2F , 6HOY , 6QCD , 6QCE , 6QCH , 6QCJ , 6XUY , 6XV1 , 6XV6 , 6XVG , 6ZU4 , 7CL0 , 7CL1 , 8AK5 , 8AK6 , 8AK7 , 8AK8 , 8AK9 , 8AKA , 8AKB , 8AKC , 8AKD , 8AKE , 8AKF , 8AKG , 8BL0 , 8BL1 , 8CNM , 8CNO , 8F86 , 8G57 , 8I2B , 8OF4 , 9G7H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	52 → 87	Sir2 family	Family
PF02146	SIR2	81 → 221	Sir2 family	Family

Sequence

MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

Sequence length

355

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Thermogenesis Central carbon metabolism in cancer		Processing of DNA double-strand break ends

SIRT6 (sirtuin 6)