SIRT6 (sirtuin 6)

Gene

• Entrez ID: 51548
• Gene name: Sirtuin 6
• Gene symbol: SIRT6
• Synonyms (NCBI Gene): SIR2L6, hSIRT6
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT735225	hsa-miR-186-5p	Western blotting, qRT-PCR	32573339
MIRT1350318	hsa-miR-1224-5p	CLIP-seq
MIRT1350319	hsa-miR-3180-5p	CLIP-seq
MIRT1350320	hsa-miR-33a	CLIP-seq
MIRT1350321	hsa-miR-33b	CLIP-seq
MIRT1350322	hsa-miR-3915	CLIP-seq
MIRT1350323	hsa-miR-4689	CLIP-seq
MIRT1350324	hsa-miR-4751	CLIP-seq
MIRT1350325	hsa-miR-520a-5p	CLIP-seq
MIRT1350326	hsa-miR-525-5p	CLIP-seq
MIRT1350327	hsa-miR-1321	CLIP-seq
MIRT1350328	hsa-miR-1915	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350331	hsa-miR-4270	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT1350333	hsa-miR-4441	CLIP-seq
MIRT1350334	hsa-miR-4739	CLIP-seq
MIRT1350335	hsa-miR-4756-5p	CLIP-seq
MIRT2103776	hsa-miR-130a	CLIP-seq
MIRT2103777	hsa-miR-130b	CLIP-seq
MIRT2103778	hsa-miR-148a	CLIP-seq
MIRT2103779	hsa-miR-148b	CLIP-seq
MIRT2103780	hsa-miR-152	CLIP-seq
MIRT2103781	hsa-miR-2682	CLIP-seq
MIRT2103782	hsa-miR-301a	CLIP-seq
MIRT2103783	hsa-miR-301b	CLIP-seq
MIRT2103784	hsa-miR-34a	CLIP-seq
MIRT2103785	hsa-miR-34c-5p	CLIP-seq
MIRT2103786	hsa-miR-3666	CLIP-seq
MIRT2103787	hsa-miR-3714	CLIP-seq
MIRT2103788	hsa-miR-4295	CLIP-seq
MIRT2103789	hsa-miR-449a	CLIP-seq
MIRT2103790	hsa-miR-449b	CLIP-seq
MIRT2103791	hsa-miR-449c	CLIP-seq
MIRT2103792	hsa-miR-454	CLIP-seq
MIRT2103793	hsa-miR-548an	CLIP-seq
MIRT2622898	hsa-miR-326	CLIP-seq
MIRT2622899	hsa-miR-330-5p	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT2622900	hsa-miR-342-5p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT2622901	hsa-miR-4455	CLIP-seq
MIRT2622902	hsa-miR-4474-3p	CLIP-seq
MIRT2622903	hsa-miR-4651	CLIP-seq
MIRT2622904	hsa-miR-4664-5p	CLIP-seq
MIRT2622905	hsa-miR-4667-5p	CLIP-seq
MIRT2622906	hsa-miR-4700-5p	CLIP-seq
MIRT2622907	hsa-miR-4778-3p	CLIP-seq
MIRT2622908	hsa-miR-608	CLIP-seq
MIRT2622909	hsa-miR-637	CLIP-seq
MIRT2622910	hsa-miR-644	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXO3	Activation	20816089

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24043303
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	23892288, 27043296, 27912097, 30374165, 33067423
GO:0000785	Component	Chromatin	IDA	26456828
GO:0000785	Component	Chromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	33067423
GO:0003682	Function	Chromatin binding	IDA	27043296, 27912097
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	IMP	33067423
GO:0003684	Function	Damaged DNA binding	IDA	31995034, 32538779
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0005515	Function	Protein binding	IPI	19135889, 23217706, 23911928
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26898756, 29555651
GO:0005634	Component	Nucleus	IDA	25819580, 26456828
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	27043296
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005783	Component	Endoplasmic reticulum	IDA	23552949
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006094	Process	Gluconeogenesis	IDA	16753578
GO:0006096	Process	Glycolytic process	IDA	20847263
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006302	Process	Double-strand break repair	IDA	28190768, 32028527
GO:0006302	Process	Double-strand break repair	IDA	21680843, 27568560
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	23892288
GO:0006338	Process	Chromatin remodeling	IDA	23892288, 33067423, 37023208
GO:0006476	Process	Protein deacetylation	IMP	27457971
GO:0006606	Process	Protein import into nucleus	IDA	20117128
GO:0006606	Process	Protein import into nucleus	IMP	20117128
GO:0006954	Process	Inflammatory response	IDA	21147091, 22267480
GO:0006974	Process	DNA damage response	IEA
GO:0007265	Process	Ras protein signal transduction	IDA	31130282
GO:0008270	Function	Zinc ion binding	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008340	Process	Determination of adult lifespan	IMP	25541994
GO:0009411	Process	Response to UV	IDA	19109893
GO:0010526	Process	Transposable element silencing	IEA
GO:0010526	Process	Transposable element silencing	ISS
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	19135889, 22753495
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	24043303, 27912097
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	ISS
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030234	Function	Enzyme regulator activity	IDA	32538779
GO:0031490	Function	Chromatin DNA binding	IDA	33067423
GO:0031491	Function	Nucleosome binding	IDA	23892288, 33067423
GO:0031491	Function	Nucleosome binding	IMP	33067423
GO:0031508	Process	Pericentric heterochromatin formation	IDA	27043296
GO:0031509	Process	Subtelomeric heterochromatin formation	IMP	21847107
GO:0031648	Process	Protein destabilization	IDA	29474172
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	29474172
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032129	Function	Histone H3K9 deacetylase activity, hydrolytic mechanism	EXP	33067423
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	23201774, 25819580
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	27457971
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	19109893, 23142079, 24052263, 25009184, 26787900, 27322069, 29474172
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0035033	Function	Histone deacetylase regulator activity	IDA	31995034, 32538779
GO:0035861	Component	Site of double-strand break	IDA	21680843, 23911928, 27568560, 31995034, 32538779
GO:0042181	Process	Ketone biosynthetic process	IEA
GO:0042181	Process	Ketone biosynthetic process	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042308	Process	Negative regulation of protein import into nucleus	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	31995034, 32538779
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	16753578
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	23142079, 25009184
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	17024043
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	21847107
GO:0045820	Process	Negative regulation of glycolytic process	IDA	26456828
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22901803, 24120661
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	25009184, 26787900
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IBA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IDA	18337721, 23892288, 26456828, 30374165, 33067423
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IMP	29555651
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0050708	Process	Regulation of protein secretion	IDA	23552949
GO:0050994	Process	Regulation of lipid catabolic process	IEA
GO:0050994	Process	Regulation of lipid catabolic process	ISS
GO:0051697	Process	Protein delipidation	IDA	23552949
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	ISS
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0070403	Function	NAD+ binding	IEA
GO:0070403	Function	NAD+ binding	ISS
GO:0090734	Component	Site of DNA damage	IDA	19109893
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IDA	27043296
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IEA
GO:0099115	Component	Chromosome, subtelomeric region	IDA	18337721
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	IEA
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28723567
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	27912097
GO:0120187	Process	Positive regulation of protein localization to chromatin	IEA
GO:0120187	Process	Positive regulation of protein localization to chromatin	ISS
GO:0140612	Function	DNA damage sensor activity	IDA	31995034, 32538779
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IDA	23911928, 26456828, 26898756, 27912097, 30374165
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IEA
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IDA	23552949, 24052263, 26456828, 27322069, 30374165, 31995034
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IDA	23552949, 24052263, 27322069, 28406396
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IMP	29555651
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IEA
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	14701750
GO:1902459	Process	Positive regulation of stem cell population maintenance	IDA	27912097
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IMP	25819580
GO:1903076	Process	Regulation of protein localization to plasma membrane	IDA	28406396
GO:1904841	Function	TORC2 complex binding	IEA
GO:1904841	Function	TORC2 complex binding	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IMP	23201774
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	23201774
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	21680843, 22753495, 27322069, 27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS
GO:2000773	Process	Negative regulation of cellular senescence	IDA	22753495, 27043296
GO:2000773	Process	Negative regulation of cellular senescence	IMP	29474172
GO:2000774	Process	Positive regulation of cellular senescence	IDA	29474172
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	23911928, 31995034, 32538779
GO:2000781	Process	Positive regulation of double-strand break repair	IEA

Other IDs

• MIM: 606211
• HGNC: 14934
• e!Ensembl: ENSG00000077463

Protein

• UniProt ID: Q8N6T7
• Protein name: NAD-dependent protein deacylase sirtuin-6 (EC 2.3.1.-) (NAD-dependent protein deacetylase sirtuin-6) (EC 2.3.1.286) (Protein mono-ADP-ribosyltransferase sirtuin-6) (EC 2.4.2.-) (Regulatory protein SIR2 homolog 6) (hSIRT6) (SIR2-like protein 6)
• Protein function: NAD-dependent protein deacetylase, deacylase and mono-ADP-ribosyltransferase that plays an essential role in DNA damage repair, telomere maintenance, metabolic homeostasis, inflammation, tumorigenesis and aging (PubMed:18337721, PubMed:19135889,
• PDB: 3K35, 3PKI, 3PKJ, 3ZG6, 5MF6, 5MFP, 5MFZ, 5MGN, 5X16, 5Y2F, 6HOY, 6QCD, 6QCE, 6QCH, 6QCJ, 6XUY, 6XV1, 6XV6, 6XVG, 6ZU4, 7CL0, 7CL1, 8AK5, 8AK6, 8AK7, 8AK8, 8AK9, 8AKA, 8AKB, 8AKC, 8AKD, 8AKE, 8AKF, 8AKG, 8BL0, 8BL1, 8CNM, 8CNO, 8F86, 8G57, 8I2B, 8OF4, 9G7H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	52 → 87	Sir2 family	Family
  PF02146	SIR2	81 → 221	Sir2 family	Family

• Sequence:

  MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
  IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
  RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
  LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
  LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
  EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

• Sequence length: 355

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways
Thermogenesis
Central carbon metabolism in cancer

Reactome:

Processing of DNA double-strand break ends

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Premature ovarian failure	Likely pathogenic	rs771714154	RCV001270238	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	31128573	★☆☆☆☆ Found in Text Mining only
Aging Premature	Associate	18337721, 35811457	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Inhibit	33910019	★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Inhibit	38365109	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	27496874	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	28296196, 33952798, 36733404	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	31701920	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	25808624, 27746184, 32681437, 35840633	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	23800187, 26675349, 35840633, 37566546	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	26631040	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30542728, 31257493, 31842909, 36124029, 36308411, 36534275, 37715252, 37763801	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	25197348, 29363378	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25227832, 25713071, 27777384, 28443459, 37566546	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	26121130	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	37096064	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	28296196	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	22087257	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Stimulate	22087257	★☆☆☆☆ Found in Text Mining only
Chromosome Breakage	Associate	31995034	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	33634990	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	26657850, 27923994, 30504065, 36807774	★☆☆☆☆ Found in Text Mining only
Communication Disorders	Associate	36327468	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	27118880, 35224092	★☆☆☆☆ Found in Text Mining only
Dental Plaque	Inhibit	34500107	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Inhibit	34500107	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	33096729, 34500107	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Associate	33096729	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	25162034	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Inhibit	38222451	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	26332421	★☆☆☆☆ Found in Text Mining only
Embolism Fat	Associate	30845774	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	26183563, 34927546	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	31906251	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	28653878	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Stimulate	28653878	★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	33568575	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	36534275	★☆☆☆☆ Found in Text Mining only
Fused Teeth	Associate	31995034	★☆☆☆☆ Found in Text Mining only
Glioma	Inhibit	29659670	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	31321952	★☆☆☆☆ Found in Text Mining only
Glucagonoma	Associate	28921546	★☆☆☆☆ Found in Text Mining only
Granulosa Cell Tumor	Associate	33669567	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Inhibit	29790697	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	27766571	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	35209148	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	21224216	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	23132960, 25162034, 26114387, 29515203, 30845774, 33096729, 33634990, 35811457, 36534275, 36958525	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	35249460	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	36534275	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	34531509	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	31928132, 32587297	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	23108383	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	27766571, 27864740, 32587297	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	36534275	★☆☆☆☆ Found in Text Mining only
Lumbar Stenosis Familial	Associate	33568575	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25197348, 25713071, 29125477	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	28653878	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	29363378	★☆☆☆☆ Found in Text Mining only
Melanoma	Inhibit	29215322	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	32789493	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	29515203	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Associate	27043296	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	26675349, 30402853	★☆☆☆☆ Found in Text Mining only
Myopathy with Lactic Acidosis Hereditary	Inhibit	28653878	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Inhibit	30845774	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27777384, 29363378, 35686673	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	31113446, 33282964	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23800187, 23860128, 25197348, 25816777, 27043296, 27746184, 27777384, 28582846, 29215322, 29515203, 30514106, 34359939, 35840633, 36534275, 37096064	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	23982738, 25400728, 25808624, 26183563, 28653878, 28921546, 32789493, 34573442, 35686673, 37566546	★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	36534275	★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	25400728	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	27118880, 35811457	★☆☆☆☆ Found in Text Mining only
Obesity	Inhibit	30845774	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	36496445	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	31477582, 31701920	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	34359939	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Inhibit	25807436	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	32541517, 35686673	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	34021216	★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	35249460	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	32681437	★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Associate	22087257	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	23982738, 33282964	★☆☆☆☆ Found in Text Mining only
Prostatitis	Stimulate	23982738	★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	27496874	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	33143333	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Inhibit	24367027, 27767101	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Inhibit	30651359	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Associate	33634990	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Inhibit	31552414	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Associate	35686673	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	23475622	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	Associate	18337721, 25819580	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	Inhibit	33568575	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Inhibit	35136826	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Inhibit	25400728	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	32066835	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	23132960	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Inhibit	23132960	★☆☆☆☆ Found in Text Mining only
Vascular Ring	Associate	33568575	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Associate	18337721	★☆☆☆☆ Found in Text Mining only