SIRT7 (sirtuin 7)

Gene

• Entrez ID: 51547
• Gene name: Sirtuin 7
• Gene symbol: SIRT7
• Synonyms (NCBI Gene): SIR2L7
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018583	hsa-miR-335-5p	Microarray	18185580
MIRT438447	hsa-miR-125a-5p	Flow, Immunoblot, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23079745
MIRT438446	hsa-miR-125b-5p	Flow, Immunoblot, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23079745
MIRT438348	hsa-miR-34a-5p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25860861
MIRT438447	hsa-miR-125a-5p	Flow, Immunoblot, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23079745
MIRT438446	hsa-miR-125b-5p	Flow, Immunoblot, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23079745
MIRT438348	hsa-miR-34a-5p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25860861
MIRT438446	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26770454
MIRT438446	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26770454
MIRT734285	hsa-miR-17-5p	Western blotting	32442343
MIRT734285	hsa-miR-17-5p	Western blotting	32442343
MIRT1350336	hsa-miR-142-5p	CLIP-seq
MIRT1350337	hsa-miR-193a-3p	CLIP-seq
MIRT1350338	hsa-miR-193b	CLIP-seq
MIRT1350339	hsa-miR-2276	CLIP-seq
MIRT1350340	hsa-miR-3117-5p	CLIP-seq
MIRT1350341	hsa-miR-3187-3p	CLIP-seq
MIRT1350342	hsa-miR-340	CLIP-seq
MIRT1350343	hsa-miR-3614-3p	CLIP-seq
MIRT1350344	hsa-miR-412	CLIP-seq
MIRT1350345	hsa-miR-4320	CLIP-seq
MIRT1350346	hsa-miR-4447	CLIP-seq
MIRT1350347	hsa-miR-4472	CLIP-seq
MIRT1350348	hsa-miR-4488	CLIP-seq
MIRT1350349	hsa-miR-4529-5p	CLIP-seq
MIRT1350350	hsa-miR-4697-5p	CLIP-seq
MIRT1350351	hsa-miR-4712-5p	CLIP-seq
MIRT1350352	hsa-miR-4772-3p	CLIP-seq
MIRT1350353	hsa-miR-4797-5p	CLIP-seq
MIRT1350354	hsa-miR-518a-5p	CLIP-seq
MIRT1350355	hsa-miR-527	CLIP-seq
MIRT1350356	hsa-miR-561	CLIP-seq
MIRT1350357	hsa-miR-770-5p	CLIP-seq
MIRT2327936	hsa-miR-106a	CLIP-seq
MIRT2327937	hsa-miR-106b	CLIP-seq
MIRT2327938	hsa-miR-1244	CLIP-seq
MIRT2327939	hsa-miR-130a	CLIP-seq
MIRT2327940	hsa-miR-130b	CLIP-seq
MIRT2327941	hsa-miR-148a	CLIP-seq
MIRT2327942	hsa-miR-148b	CLIP-seq
MIRT2327943	hsa-miR-152	CLIP-seq
MIRT2327944	hsa-miR-17	CLIP-seq
MIRT1350337	hsa-miR-193a-3p	CLIP-seq
MIRT1350338	hsa-miR-193b	CLIP-seq
MIRT2327945	hsa-miR-20a	CLIP-seq
MIRT2327946	hsa-miR-20b	CLIP-seq
MIRT2327947	hsa-miR-2116	CLIP-seq
MIRT1350339	hsa-miR-2276	CLIP-seq
MIRT2327948	hsa-miR-301a	CLIP-seq
MIRT2327949	hsa-miR-301b	CLIP-seq
MIRT1350340	hsa-miR-3117-5p	CLIP-seq
MIRT1350341	hsa-miR-3187-3p	CLIP-seq
MIRT2327950	hsa-miR-3666	CLIP-seq
MIRT2327951	hsa-miR-411	CLIP-seq
MIRT2327952	hsa-miR-4287	CLIP-seq
MIRT2327953	hsa-miR-4295	CLIP-seq
MIRT2327954	hsa-miR-4435	CLIP-seq
MIRT2327955	hsa-miR-4469	CLIP-seq
MIRT2327956	hsa-miR-4519	CLIP-seq
MIRT1350349	hsa-miR-4529-5p	CLIP-seq
MIRT2327957	hsa-miR-454	CLIP-seq
MIRT2327958	hsa-miR-4677-5p	CLIP-seq
MIRT2327959	hsa-miR-4685-3p	CLIP-seq
MIRT2327960	hsa-miR-4708-3p	CLIP-seq
MIRT2327961	hsa-miR-4713-5p	CLIP-seq
MIRT2327962	hsa-miR-4715-3p	CLIP-seq
MIRT2327963	hsa-miR-4755-3p	CLIP-seq
MIRT1350352	hsa-miR-4772-3p	CLIP-seq
MIRT2327964	hsa-miR-516a-3p	CLIP-seq
MIRT1350354	hsa-miR-518a-5p	CLIP-seq
MIRT2327965	hsa-miR-519d	CLIP-seq
MIRT2327966	hsa-miR-520g	CLIP-seq
MIRT2327967	hsa-miR-520h	CLIP-seq
MIRT1350355	hsa-miR-527	CLIP-seq
MIRT2327968	hsa-miR-562	CLIP-seq
MIRT2327969	hsa-miR-93	CLIP-seq
MIRT1350337	hsa-miR-193a-3p	CLIP-seq
MIRT1350338	hsa-miR-193b	CLIP-seq
MIRT2440425	hsa-miR-3176	CLIP-seq
MIRT2440426	hsa-miR-3178	CLIP-seq
MIRT2440427	hsa-miR-3672	CLIP-seq
MIRT2440428	hsa-miR-3922-3p	CLIP-seq
MIRT2440429	hsa-miR-4299	CLIP-seq
MIRT2440430	hsa-miR-4463	CLIP-seq
MIRT2440431	hsa-miR-4486	CLIP-seq
MIRT2440432	hsa-miR-4710	CLIP-seq
MIRT2440433	hsa-miR-4792	CLIP-seq
MIRT2327941	hsa-miR-148a	CLIP-seq
MIRT2327942	hsa-miR-148b	CLIP-seq
MIRT2327943	hsa-miR-152	CLIP-seq
MIRT1350337	hsa-miR-193a-3p	CLIP-seq
MIRT1350338	hsa-miR-193b	CLIP-seq
MIRT2622911	hsa-miR-2115	CLIP-seq
MIRT2440425	hsa-miR-3176	CLIP-seq
MIRT2440426	hsa-miR-3178	CLIP-seq
MIRT2622912	hsa-miR-3665	CLIP-seq
MIRT2440427	hsa-miR-3672	CLIP-seq
MIRT2622913	hsa-miR-3909	CLIP-seq
MIRT2440428	hsa-miR-3922-3p	CLIP-seq
MIRT2622914	hsa-miR-3934	CLIP-seq
MIRT2440429	hsa-miR-4299	CLIP-seq
MIRT2327954	hsa-miR-4435	CLIP-seq
MIRT2622915	hsa-miR-4436b-5p	CLIP-seq
MIRT2440430	hsa-miR-4463	CLIP-seq
MIRT2440431	hsa-miR-4486	CLIP-seq
MIRT2327956	hsa-miR-4519	CLIP-seq
MIRT2440432	hsa-miR-4710	CLIP-seq
MIRT2622916	hsa-miR-4736	CLIP-seq
MIRT2622917	hsa-miR-4743	CLIP-seq
MIRT2327963	hsa-miR-4755-3p	CLIP-seq
MIRT2440433	hsa-miR-4792	CLIP-seq
MIRT2622918	hsa-miR-642b	CLIP-seq
MIRT2622912	hsa-miR-3665	CLIP-seq
MIRT2622914	hsa-miR-3934	CLIP-seq
MIRT2622916	hsa-miR-4736	CLIP-seq
MIRT2622917	hsa-miR-4743	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22722849
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	30944854
GO:0000785	Component	Chromatin	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	ISS
GO:0003682	Function	Chromatin binding	IDA	22722849
GO:0005515	Function	Protein binding	IPI	19174463, 22722849, 24207024, 25792330, 26867678, 28426094, 28655758, 28790157, 30420520, 30540930, 30944854, 31075303
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	36646384
GO:0005634	Component	Nucleus	IDA	31075303
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	24207024, 28886238
GO:0005654	Component	Nucleoplasm	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	16079181, 24207024, 28426094, 28886238
GO:0005730	Component	Nucleolus	IEA
GO:0005731	Component	Nucleolus organizer region	IDA	19174463
GO:0005737	Component	Cytoplasm	IC	28147277
GO:0005737	Component	Cytoplasm	IEA
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IDA	30944854
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	28426094
GO:0006476	Process	Protein deacetylation	IDA	24207024, 26867678, 28790157, 28886238, 30944854, 31075303
GO:0006974	Process	DNA damage response	IDA	30944854
GO:0006974	Process	DNA damage response	IEA
GO:0007129	Process	Homologous chromosome pairing at meiosis	IEA
GO:0007129	Process	Homologous chromosome pairing at meiosis	ISS
GO:0008276	Function	Protein methyltransferase activity	IDA	24207024
GO:0009303	Process	RRNA transcription	IMP	19174463
GO:0010526	Process	Transposable element silencing	IEA
GO:0010526	Process	Transposable element silencing	ISS
GO:0010821	Process	Regulation of mitochondrion organization	IEA
GO:0010821	Process	Regulation of mitochondrion organization	IMP	30420520
GO:0010821	Process	Regulation of mitochondrion organization	ISS
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	28886238
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	24207024, 26867678, 28426094, 28790157, 28886238, 30540930, 30944854, 31075303
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0035861	Component	Site of double-strand break	IDA	27436229
GO:0035861	Component	Site of double-strand break	IEA
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IBA
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IDA	27436229
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0045722	Process	Positive regulation of gluconeogenesis	IMP	28655758
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IEA
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IDA	28655758
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IDA	30540930
GO:0046825	Process	Regulation of protein export from nucleus	IEA
GO:0046825	Process	Regulation of protein export from nucleus	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17386267
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IBA
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IDA	31542297
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IEA
GO:0061698	Process	Protein deglutarylation	IDA	31542297
GO:0062176	Process	R-loop processing	IDA	28790157
GO:0070403	Function	NAD+ binding	IEA
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IBA
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IDA	22722849, 26907567, 30420520, 30653310, 35939806
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IEA
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IMP	28655758
GO:0106230	Process	Protein depropionylation	ISS
GO:0106231	Function	NAD-dependent protein-lysine depropionylase activity	IEA
GO:0106231	Function	NAD-dependent protein-lysine depropionylase activity	ISS
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IBA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	27436229
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	ISS
GO:1901836	Process	Regulation of transcription of nucleolar large rRNA by RNA polymerase I	IDA	24207024
GO:2000234	Process	Positive regulation of rRNA processing	IDA	26867678

Other IDs

• MIM: 606212
• HGNC: 14935
• e!Ensembl: ENSG00000187531

Protein

• UniProt ID: Q9NRC8
• Protein name: NAD-dependent protein deacetylase sirtuin-7 (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-7) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 7) (SIR2-like protein 7)
• Protein function: NAD-dependent protein-lysine deacylase that can act both as a deacetylase or deacylase (desuccinylase, depropionylase, deglutarylase and dedecanoylase), depending on the context (PubMed:22722849, PubMed:26907567, PubMed:30653310, PubMed:31542297
• PDB: 5IQZ, 6G0S, 9GMK, 9GMR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	132 → 275	Sir2 family	Family

• Sequence:

  MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTE
  LQGRSRRREGLKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYR
  GPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPR
  TAISELHGNMYIEVCTSCVPNREYVRVFDVTERTALHRHQTGRTCHKCGTQLRDTIVHFG
  ERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQW
  TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSL
  CRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT

• Sequence length: 400

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	31074380	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Stimulate	36012298	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	30627559	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	17003781	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	25973086, 28147277, 33617509, 37056924	★☆☆☆☆ Found in Text Mining only
Calcinosis	Associate	35708762	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	25923013	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	23800187, 27997115, 37957720	★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	25923013	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	26631040	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	28445974, 36308411	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31683458	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Stimulate	35422493	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	37096064	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	37957720	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	33015765	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Associate	37056924	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	30282801	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Associate	35708762	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Associate	35708762	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Associate	33096729	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	26701732	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	31906251	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Inhibit	27246221	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Associate	27997115	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucosephosphate Dehydrogenase Deficiency	Associate	34981113	★☆☆☆☆ Found in Text Mining only
Granulosa Cell Tumor	Associate	33669567	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Associate	27669435	★☆☆☆☆ Found in Text Mining only
Infant Premature Diseases	Associate	34981113	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35411569	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	32214204	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	32214204	★☆☆☆☆ Found in Text Mining only
Limbal Stem Cell Deficiency	Associate	32214204	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	31613681, 31683458, 39908142	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	30001742	★☆☆☆☆ Found in Text Mining only
Melanoma	Stimulate	36918544	★☆☆☆☆ Found in Text Mining only
Microsatellite Instability	Associate	39908142	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	25860861, 25923013, 37056924	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	30001742	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	31113446	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23800187, 24885964, 25794641, 25921180, 25923013, 25973086, 28445974, 28582846, 30001742, 31074380, 32404984, 36918544, 37096064, 37957720, 39873399, 39908142	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	24113281, 26121130, 30282801, 32214204, 35422493, 35686673	★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	33015765	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	33015765	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	25921180, 32541517	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26121130, 35422493	★☆☆☆☆ Found in Text Mining only
Pulpitis	Associate	35411569	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	23475622, 30001742	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	25860861	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	25860861	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	26679092	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	12454781	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	25794641	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	34981113	★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	37848382	★☆☆☆☆ Found in Text Mining only