Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51530
Gene name	Zinc finger C3HC-type containing 1
Gene symbol	ZC3HC1
Synonyms (NCBI Gene)	HSPC216NIPA
Chromosome	7
Chromosome location	7q32.2
Summary	This gene encodes an F-box-containing protein that is a component of an SCF-type E3 ubiquitin ligase complex that regulates the onset of cell division. The G2/M transition in the cell cycle requires the interaction of the proteins cyclin B1 and cyclin-dep

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments
MIRT1506606	hsa-miR-1237	CLIP-seq
MIRT1506607	hsa-miR-1248	CLIP-seq
MIRT1506608	hsa-miR-4474-5p	CLIP-seq
MIRT1506609	hsa-miR-554	CLIP-seq
MIRT2372908	hsa-miR-10a	CLIP-seq
MIRT2372909	hsa-miR-10b	CLIP-seq
MIRT2372910	hsa-miR-188-3p	CLIP-seq
MIRT2372911	hsa-miR-2053	CLIP-seq
MIRT2372912	hsa-miR-483-3p	CLIP-seq
MIRT2372913	hsa-miR-569	CLIP-seq
MIRT2665653	hsa-miR-1207-5p	CLIP-seq
MIRT2665654	hsa-miR-183	CLIP-seq
MIRT2665655	hsa-miR-1909	CLIP-seq
MIRT2665656	hsa-miR-3117-5p	CLIP-seq
MIRT2665657	hsa-miR-3121-5p	CLIP-seq
MIRT2665658	hsa-miR-3680	CLIP-seq
MIRT2665659	hsa-miR-4283	CLIP-seq
MIRT2665660	hsa-miR-4448	CLIP-seq
MIRT2665661	hsa-miR-4736	CLIP-seq
MIRT2665662	hsa-miR-4763-3p	CLIP-seq
MIRT2665653	hsa-miR-1207-5p	CLIP-seq
MIRT2665654	hsa-miR-183	CLIP-seq
MIRT2665655	hsa-miR-1909	CLIP-seq
MIRT2665656	hsa-miR-3117-5p	CLIP-seq
MIRT2665657	hsa-miR-3121-5p	CLIP-seq
MIRT2665658	hsa-miR-3680	CLIP-seq
MIRT2665659	hsa-miR-4283	CLIP-seq
MIRT2665661	hsa-miR-4736	CLIP-seq
MIRT2665662	hsa-miR-4763-3p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16105984, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019901	Function	Protein kinase binding	IPI	16105984
GO:0031965	Component	Nuclear membrane	IDA
GO:0044615	Component	Nuclear pore nuclear basket	IDA	34440706
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
619746	29913	ENSG00000091732

Q86WB0

Protein name

Zinc finger C3HC-type protein 1 (Nuclear-interacting partner of ALK) (hNIPA) (Nuclear-interacting partner of anaplastic lymphoma kinase)

Protein function

Required for proper positioning of a substantial amount of TPR at the nuclear basket (NB) through interaction with TPR.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07967	zf-C3HC	72 → 201	C3HC zinc finger-like	Domain
PF08600	Rsm1	248 → 344	Rsm1-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in heart, skeletal muscle and testis. Expressed in brain, placenta, lung, kidney, liver, pancreas, spleen, thymus, prostate, ovary small intestine and colon. Weakly or not expressed in leukocytes. {EC

Sequence

MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVN
GSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSC
QAFLCASLQPAFDFDRYKQRCAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVS
EFLDRFQSLCHLDLQLPSLRPEDLKTMCLTEDKISLLLHLLEDELDHRTDERKTTIKLGS
DIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGL
TSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSP
VDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD
PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSM
SLSEKSRKVFRIFRQWESLCSC

Sequence length

502

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs756680606	RCV005927252

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	24286297
Atherosclerosis	Associate	24286297
Cardiovascular Diseases	Associate	30642433
Coronary Artery Disease	Associate	21966275, 24286297, 26266351, 27226629, 32600345
Dementia	Associate	30642433
Essential Hypertension	Associate	26266351
Graft vs Host Disease	Stimulate	11861270
Hypertension	Associate	26266351, 31507094
Lung Neoplasms	Associate	30642433
Lymphoma Large Cell Anaplastic	Associate	31434245
Vascular Diseases	Associate	34565088

ZC3HC1 (zinc finger C3HC-type containing 1)