ZC3HC1 (zinc finger C3HC-type containing 1)

Gene

• Entrez ID: 51530
• Gene name: Zinc finger C3HC-type containing 1
• Gene symbol: ZC3HC1
• Synonyms (NCBI Gene): HSPC216, NIPA
• Chromosome: 7
• Chromosome location: 7q32.2
• Summary: This gene encodes an F-box-containing protein that is a component of an SCF-type E3 ubiquitin ligase complex that regulates the onset of cell division. The G2/M transition in the cell cycle requires the interaction of the proteins cyclin B1 and cyclin-dep

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1506606	hsa-miR-1237	CLIP-seq
MIRT1506607	hsa-miR-1248	CLIP-seq
MIRT1506608	hsa-miR-4474-5p	CLIP-seq
MIRT1506609	hsa-miR-554	CLIP-seq
MIRT2372908	hsa-miR-10a	CLIP-seq
MIRT2372909	hsa-miR-10b	CLIP-seq
MIRT2372910	hsa-miR-188-3p	CLIP-seq
MIRT2372911	hsa-miR-2053	CLIP-seq
MIRT2372912	hsa-miR-483-3p	CLIP-seq
MIRT2372913	hsa-miR-569	CLIP-seq
MIRT2665653	hsa-miR-1207-5p	CLIP-seq
MIRT2665654	hsa-miR-183	CLIP-seq
MIRT2665655	hsa-miR-1909	CLIP-seq
MIRT2665656	hsa-miR-3117-5p	CLIP-seq
MIRT2665657	hsa-miR-3121-5p	CLIP-seq
MIRT2665658	hsa-miR-3680	CLIP-seq
MIRT2665659	hsa-miR-4283	CLIP-seq
MIRT2665660	hsa-miR-4448	CLIP-seq
MIRT2665661	hsa-miR-4736	CLIP-seq
MIRT2665662	hsa-miR-4763-3p	CLIP-seq
MIRT2665653	hsa-miR-1207-5p	CLIP-seq
MIRT2665654	hsa-miR-183	CLIP-seq
MIRT2665655	hsa-miR-1909	CLIP-seq
MIRT2665656	hsa-miR-3117-5p	CLIP-seq
MIRT2665657	hsa-miR-3121-5p	CLIP-seq
MIRT2665658	hsa-miR-3680	CLIP-seq
MIRT2665659	hsa-miR-4283	CLIP-seq
MIRT2665661	hsa-miR-4736	CLIP-seq
MIRT2665662	hsa-miR-4763-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16105984
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA
GO:0005654	Component	Nucleoplasm	IDA
GO:0007049	Process	Cell cycle	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019901	Function	Protein kinase binding	IPI	16105984
GO:0031965	Component	Nuclear membrane	IDA
GO:0051301	Process	Cell division	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

Other IDs

• MIM: 619746
• HGNC: 29913
• e!Ensembl: ENSG00000091732

Protein

• UniProt ID: Q86WB0
• Protein name: Zinc finger C3HC-type protein 1 (Nuclear-interacting partner of ALK) (hNIPA) (Nuclear-interacting partner of anaplastic lymphoma kinase)
• Protein function: Required for proper positioning of a substantial amount of TPR at the nuclear basket (NB) through interaction with TPR.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07967	zf-C3HC	72 → 201	C3HC zinc finger-like	Domain
  PF08600	Rsm1	248 → 344	Rsm1-like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highly expressed in heart, skeletal muscle and testis. Expressed in brain, placenta, lung, kidney, liver, pancreas, spleen, thymus, prostate, ovary small intestine and colon. Weakly or not expressed in leukocytes. {EC
• Sequence:

  MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVN
  GSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSC
  QAFLCASLQPAFDFDRYKQRCAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVS
  EFLDRFQSLCHLDLQLPSLRPEDLKTMCLTEDKISLLLHLLEDELDHRTDERKTTIKLGS
  DIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGL
  TSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSP
  VDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD
  PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSM
  SLSEKSRKVFRIFRQWESLCSC

• Sequence length: 502

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Coronary artery disease	CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1, Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	23202125, 21378990, 29212778, 26343387, 28714975, 24262325
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	28869590

Unknown
Disease term	Disease name	Evidence	References	Source
Coronary heart disease	Coronary heart disease		21966275, 21378990, 24262325, 22319020, 28869590	ClinVar
Myocardial infarction	Myocardial Infarction		26343387	ClinVar
Myocardial Infarction	Myocardial Infarction			GWAS
Coronary Heart Disease	Coronary Heart Disease			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS
Hypertension	Hypertension			GWAS
Heart Failure	Heart Failure			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Rheumatoid	Associate	24286297
Atherosclerosis	Associate	24286297
Cardiovascular Diseases	Associate	30642433
Coronary Artery Disease	Associate	21966275, 24286297, 26266351, 27226629, 32600345
Dementia	Associate	30642433
Essential Hypertension	Associate	26266351
Graft vs Host Disease	Stimulate	11861270
Hypertension	Associate	26266351, 31507094
Lung Neoplasms	Associate	30642433
Lymphoma Large Cell Anaplastic	Associate	31434245
Vascular Diseases	Associate	34565088