Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51527
Gene name Gene Name - the full gene name approved by the HGNC.	GSK3B interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSKIP
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf129, HSPC210
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is involved as a negative regulator of GSK3-beta in the Wnt signaling pathway. The encoded protein may play a role in the retinoic acid signaling pathway by regulating the functional interactions between GSK3-beta, beta-ca

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT559864	hsa-miR-548ac	PAR-CLIP	20371350
MIRT559863	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT559862	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT559861	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT559860	hsa-miR-548z	PAR-CLIP	20371350
MIRT559859	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT559858	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT559857	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT559856	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT559855	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT559854	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT559853	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT559852	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT559851	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT559850	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559849	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559847	hsa-miR-6079	PAR-CLIP	20371350
MIRT728158	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728157	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728156	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728154	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT728155	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT728153	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT559864	hsa-miR-548ac	PAR-CLIP	20371350
MIRT559863	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT559862	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT559861	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT559860	hsa-miR-548z	PAR-CLIP	20371350
MIRT559859	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT559858	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT559857	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT559856	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT559855	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT559854	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT559853	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT559852	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT559851	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT559850	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT559849	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT559847	hsa-miR-6079	PAR-CLIP	20371350

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004860	Function	Protein kinase inhibitor activity	IDA	19830702
GO:0004860	Function	Protein kinase inhibitor activity	IMP	16981698
GO:0005515	Function	Protein binding	IPI	20007971, 25920809, 27484798
GO:0005634	Component	Nucleus	IDA	20007971
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	16981698, 20007971
GO:0006469	Process	Negative regulation of protein kinase activity	IMP	16981698
GO:0008013	Function	Beta-catenin binding	IDA	27484798
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IMP	25920809
GO:0019207	Function	Kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	16981698
GO:0030111	Process	Regulation of Wnt signaling pathway	IBA	21873635
GO:0030111	Process	Regulation of Wnt signaling pathway	IMP	16981698
GO:0034237	Function	Protein kinase A regulatory subunit binding	IPI	27484798
GO:0051018	Function	Protein kinase A binding	IBA	21873635
GO:0051018	Function	Protein kinase A binding	IPI	20007971, 25920809
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	27484798

MIM	HGNC	e!Ensembl
616605	20343	ENSG00000100744

Protein

UniProt ID

Q9P0R6

Protein name

GSK3B-interacting protein (GSKIP) (GSK3beta interaction protein)

Protein function

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets (PubMed:16981698, PubMed:25920809, PubMed:27484798). The ternary complex enhances Wnt-induced signaling by facilitating the GS

PDB

1SGO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05303	DUF727	33 → 133	Protein of unknown function (DUF727)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas. {ECO:0000269|PubMed:16981698}.

Sequence

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCA
DDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYRE
AFGNALLQRLEALKRDGQS

Sequence length

139

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Myeloproliferative disorder	Myeloproliferative disease	rs267606708, rs77375493	26280900

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	36550871
Chromosome Deletion	Associate	32917334
Diabetes Mellitus Type 2	Associate	27484798
Genetic Diseases Inborn	Associate	32917334
Inflammation	Associate	27484798
Meningioma	Associate	36550871
Parkinson Disease	Associate	27484798

GSKIP (GSK3B interacting protein)