PDE9A (phosphodiesterase 9A)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5152
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphodiesterase 9A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDE9A
Synonyms (NCBI Gene) Gene synonyms aliases
HSPDE9A2
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple t
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1221078 hsa-miR-1915 CLIP-seq
MIRT1221079 hsa-miR-4436b-3p CLIP-seq
MIRT1221080 hsa-miR-4660 CLIP-seq
MIRT1221081 hsa-miR-4685-5p CLIP-seq
MIRT1221082 hsa-miR-4755-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0004114 Function 3',5'-cyclic-nucleotide phosphodiesterase activity IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 19060904, 25416956, 26871637, 29892012, 31515488
GO:0005654 Component Nucleoplasm IDA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005794 Component Golgi apparatus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602973 8795 ENSG00000160191
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O76083
Protein name High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (EC 3.1.4.35)
Protein function Specifically hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes. Highly specific: compared to other members of the cyclic nucleotide phosphodiesterase family, has the highest affinity and sel
PDB 2HD1 , 2YY2 , 3DY8 , 3DYL , 3DYN , 3DYQ , 3DYS , 3JSI , 3JSW , 3K3E , 3K3H , 3N3Z , 3QI3 , 3QI4 , 4E90 , 4G2J , 4G2L , 4GH6 , 4Y86 , 4Y87 , 4Y8C , 6A3N , 6LZZ , 7F0I , 8BPY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00233 PDEase_I 311 → 542 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood (PubMed:9624146). Highest levels in brain, heart, kidn
Sequence 
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Sequence length 593
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Purine metabolism
Metabolic pathways 		  cGMP effects
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Hypertension Hypertension GWAS
Dementia Dementia GWAS
Alzheimer disease Alzheimer disease GWAS
Restless Legs Syndrome Restless Legs Syndrome GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining
Disease Name Relationship Type References
Anemia Sickle Cell Associate 18564357
Colorectal Neoplasms Associate 37446311
Down Syndrome Associate 22132128
Neoplasms Associate 23544068
Parkinson Disease Associate 40240887
Pulmonary Disease Chronic Obstructive Associate 33658578