Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51513
Gene name	ETS variant transcription factor 7
Gene symbol	ETV7
Synonyms (NCBI Gene)	TEL-2TEL2TELB
Chromosome	6
Chromosome location	6p21.31
Summary	The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and di

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023696	hsa-miR-1-3p	Microarray	18668037
MIRT488939	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT488938	hsa-miR-922	PAR-CLIP	23592263
MIRT488937	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT488936	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT488935	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT488934	hsa-miR-4530	PAR-CLIP	23592263
MIRT488933	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT488932	hsa-miR-4450	PAR-CLIP	23592263
MIRT488931	hsa-miR-6511b-5p	PAR-CLIP	23592263
MIRT488929	hsa-miR-6811-5p	PAR-CLIP	23592263
MIRT488939	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT488938	hsa-miR-922	PAR-CLIP	23592263
MIRT488937	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT488936	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT488935	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT488934	hsa-miR-4530	PAR-CLIP	23592263
MIRT488933	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT488932	hsa-miR-4450	PAR-CLIP	23592263
MIRT488931	hsa-miR-6511b-5p	PAR-CLIP	23592263
MIRT488929	hsa-miR-6811-5p	PAR-CLIP	23592263
MIRT972127	hsa-miR-1193	CLIP-seq
MIRT972128	hsa-miR-3614-3p	CLIP-seq
MIRT972129	hsa-miR-3689a-3p	CLIP-seq
MIRT972130	hsa-miR-3689c	CLIP-seq
MIRT972131	hsa-miR-4297	CLIP-seq
MIRT972132	hsa-miR-4728-5p	CLIP-seq
MIRT972133	hsa-miR-4328	CLIP-seq
MIRT972134	hsa-miR-582-5p	CLIP-seq
MIRT972135	hsa-miR-3192	CLIP-seq
MIRT972136	hsa-miR-3194-3p	CLIP-seq
MIRT972137	hsa-miR-346	CLIP-seq
MIRT972129	hsa-miR-3689a-3p	CLIP-seq
MIRT972130	hsa-miR-3689c	CLIP-seq
MIRT972138	hsa-miR-4294	CLIP-seq
MIRT972131	hsa-miR-4297	CLIP-seq
MIRT972132	hsa-miR-4728-5p	CLIP-seq
MIRT972139	hsa-miR-4731-5p	CLIP-seq
MIRT972140	hsa-miR-765	CLIP-seq
MIRT2222453	hsa-miR-150	CLIP-seq
MIRT2222454	hsa-miR-1915	CLIP-seq
MIRT2222455	hsa-miR-3175	CLIP-seq
MIRT2222456	hsa-miR-342-5p	CLIP-seq
MIRT2222457	hsa-miR-4664-5p	CLIP-seq
MIRT2222458	hsa-miR-4713-5p	CLIP-seq
MIRT2222459	hsa-miR-4726-3p	CLIP-seq
MIRT2222460	hsa-miR-532-3p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11108721
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11108721
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11108721
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	12588862
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10828014
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10828014
GO:0009887	Process	Animal organ morphogenesis	TAS	10828014
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
605255	18160	ENSG00000010030

Q9Y603

Protein name

Transcription factor ETV7 (ETS translocation variant 7) (ETS-related protein Tel2) (Tel-related Ets factor) (Transcription factor Tel-2)

Protein function

Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.

PDB

9HK0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	39 → 117	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	225 → 305	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in hematopoietic tissues.

Sequence

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVL
HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
VCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA
RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE
PYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP

Sequence length

341

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Stimulate	17172821, 37041130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	30025229, 34315857	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	17172821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	32908909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	38200280	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30025229	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Associate	39746786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	37041130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	33424867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	34755873, 34926692, 35704796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	37041130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	32544083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	36214761	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34926692	★★★★★ ★☆☆☆☆ Found in Text Mining only

ETV7 (ETS variant transcription factor 7)