Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5151
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphodiesterase 8A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDE8A
Synonyms (NCBI Gene) Gene synonyms aliases	HsT19550
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047034	hsa-miR-183-5p	CLASH	23622248
MIRT438310	hsa-miR-33a-5p	Immunoprecipitaion, microarray, qRT-PCR	25202981
MIRT438310	hsa-miR-33a-5p	Immunoprecipitaion, microarray, qRT-PCR	25202981
MIRT1221046	hsa-miR-1233	CLIP-seq
MIRT1221047	hsa-miR-149	CLIP-seq
MIRT1221048	hsa-miR-1537	CLIP-seq
MIRT1221049	hsa-miR-1827	CLIP-seq
MIRT1221050	hsa-miR-203	CLIP-seq
MIRT1221051	hsa-miR-28-5p	CLIP-seq
MIRT1221052	hsa-miR-3064-5p	CLIP-seq
MIRT1221053	hsa-miR-3139	CLIP-seq
MIRT1221054	hsa-miR-3646	CLIP-seq
MIRT1221055	hsa-miR-3662	CLIP-seq
MIRT1221056	hsa-miR-3664-3p	CLIP-seq
MIRT1221057	hsa-miR-3942-3p	CLIP-seq
MIRT1221058	hsa-miR-4290	CLIP-seq
MIRT1221059	hsa-miR-4292	CLIP-seq
MIRT1221060	hsa-miR-4470	CLIP-seq
MIRT1221061	hsa-miR-4649-3p	CLIP-seq
MIRT1221062	hsa-miR-4738-3p	CLIP-seq
MIRT1221063	hsa-miR-4794	CLIP-seq
MIRT1221064	hsa-miR-604	CLIP-seq
MIRT1221065	hsa-miR-647	CLIP-seq
MIRT1221066	hsa-miR-708	CLIP-seq
MIRT1221067	hsa-miR-873	CLIP-seq
MIRT2063773	hsa-miR-1207-5p	CLIP-seq
MIRT2063774	hsa-miR-145	CLIP-seq
MIRT2063775	hsa-miR-1909	CLIP-seq
MIRT2063776	hsa-miR-3121-5p	CLIP-seq
MIRT2063777	hsa-miR-3180-5p	CLIP-seq
MIRT2063778	hsa-miR-3611	CLIP-seq
MIRT1221056	hsa-miR-3664-3p	CLIP-seq
MIRT2063779	hsa-miR-3671	CLIP-seq
MIRT2063780	hsa-miR-4272	CLIP-seq
MIRT1221058	hsa-miR-4290	CLIP-seq
MIRT2063781	hsa-miR-4686	CLIP-seq
MIRT2063782	hsa-miR-4688	CLIP-seq
MIRT2063783	hsa-miR-4699-5p	CLIP-seq
MIRT2063784	hsa-miR-4736	CLIP-seq
MIRT2063785	hsa-miR-4761-5p	CLIP-seq
MIRT2063786	hsa-miR-4763-3p	CLIP-seq
MIRT2063787	hsa-miR-4775	CLIP-seq
MIRT2063788	hsa-miR-508-5p	CLIP-seq
MIRT2063789	hsa-miR-590-3p	CLIP-seq
MIRT2063790	hsa-miR-607	CLIP-seq
MIRT2063791	hsa-miR-668	CLIP-seq
MIRT1221067	hsa-miR-873	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	23509299
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IBA	21873635
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IBA	21873635
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IMP	9618252
GO:0005829	Component	Cytosol	TAS
GO:0006198	Process	CAMP catabolic process	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IEA
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0019900	Function	Kinase binding	IPI	23509299
GO:0046872	Function	Metal ion binding	IEA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IDA	9618252
GO:0060548	Process	Negative regulation of cell death	IMP	23509299
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	23509299
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IBA	21873635
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IMP	23509299
GO:1903206	Process	Negative regulation of hydrogen peroxide-induced cell death	IMP	23509299

MIM	HGNC	e!Ensembl
602972	8793	ENSG00000073417

Protein

UniProt ID

O60658

Protein name

High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC 3.1.4.53)

Protein function

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (PubMed:18983167). May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell developme

PDB

3ECM , 3ECN , 7CWA , 7CWF , 7CWG , 7VSL , 7VTV , 7VTW , 7VTX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00989	PAS	216 → 325	PAS fold	Domain
PF00233	PDEase_I	555 → 807		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.

Sequence

MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE

Sequence length

829

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Cortisol synthesis and secretion Cushing syndrome Morphine addiction		G alpha (s) signalling events

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Bulimia	Bulimia	GWAS
Gout	Gout	GWAS
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWAS
Psoriasis	Psoriasis	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Aphakia congenital primary	Associate	32875319
Atrial Fibrillation	Stimulate	36810794
Depressive Disorder	Associate	31332697
Hamartoma Syndrome Multiple	Associate	32875319
Lupus Erythematosus Systemic	Associate	31332697
Turner Syndrome	Associate	24324027

PDE8A (phosphodiesterase 8A)