NOP16 (NOP16 nucleolar protein)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51491
Gene name Gene Name - the full gene name approved by the HGNC.
NOP16 nucleolar protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NOP16
Synonyms (NCBI Gene) Gene synonyms aliases
HSPC111, HSPC185
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. [provi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT021296 hsa-miR-125a-5p Sequencing 20371350
MIRT025600 hsa-miR-10a-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IBA 21873635
GO:0005730 Component Nucleolus IDA
GO:0042273 Process Ribosomal large subunit biogenesis IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
612861 26934 ENSG00000048162
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q9Y3C1
Protein name Nucleolar protein 16 (HBV pre-S2 trans-regulated protein 3)
PDB 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09420 Nop16 7 → 87 Ribosome biogenesis protein Nop16 Family
PF09420 Nop16 65 → 156 Ribosome biogenesis protein Nop16 Family
Sequence 
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAV
DPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR
YMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Sequence length 178
Interactions View interactions