PDE6H (phosphodiesterase 6H)

Gene

• Entrez ID: 5149
• Gene name: Phosphodiesterase 6H
• Gene symbol: PDE6H
• Synonyms (NCBI Gene): ACHM6, RCD3
• Chromosome: 12
• Chromosome location: 12p12.3
• Summary: This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017528	hsa-miR-335-5p	Microarray	18185580
MIRT1220882	hsa-miR-421	CLIP-seq
MIRT1220883	hsa-miR-4709-5p	CLIP-seq
MIRT2292169	hsa-miR-488	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0004857	Function	Enzyme inhibitor activity	TAS	8786098
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0007601	Process	Visual perception	IEA
GO:0030553	Function	CGMP binding	IEA
GO:0042622	Component	Photoreceptor outer segment membrane	IBA	21873635
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IBA	21873635
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IEA
GO:0050896	Process	Response to stimulus	IEA

Other IDs

• MIM: 601190
• HGNC: 8790
• e!Ensembl: ENSG00000139053

Protein

• UniProt ID: Q13956
• Protein name: Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)
• Protein function: Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04868	PDE6_gamma	2 → 83	Retinal cGMP phosphodiesterase, gamma subunit	Family

• Sequence:

  MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDI
  TVICPWEAFSHLELHELAQFGII

• Sequence length: 83

Pathways

KEGG:

Purine metabolism
Metabolic pathways

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Achromatopsia	Achromatopsia, ACHROMATOPSIA 6	rs121918344, rs267606739, rs397515360, rs121918537, rs121918538, rs786200908, rs796051871, rs121918539, rs387906401, rs267606936, rs786200909, rs786200910, rs267606934, rs267606937, rs267606935, rs786200911, rs104893612, rs104893613, rs104893614, rs104893615, rs104893616, rs104893617, rs137852608, rs104893619, rs104893620, rs104893621, rs121434585, rs2101121827, rs146640460, rs199474697, rs372006750, rs786204762, rs373862340, rs773372519, rs768345097, rs201794629, rs786204492, rs786204498, rs150115958, rs753625117, rs786205532, rs869320751, rs761357250, rs796065053, rs797045170, rs797045171, rs797045173, rs797045174, rs761129859, rs797045172, rs757470958, rs552069173, rs777509481, rs886063161, rs745557293, rs1057517388, rs1057517454, rs1057516571, rs1057516504, rs1057516825, rs1057516878, rs1057516866, rs1057517167, rs1057517052, rs1057517053, rs748993388, rs1057516791, rs1057517434, rs1057516782, rs376711003, rs1057518098, rs775796581, rs1554604525, rs1554604767, rs1554604833, rs1362472371, rs1554604851, rs1375507464, rs1554607546, rs1554607553, rs964530890, rs1554608319, rs772725807, rs1554609946, rs1554609956, rs768735888, rs773381712, rs999921351, rs373270306, rs201320564, rs1554610279, rs1554610284, rs35010099, rs1026427970, rs1554610655, rs776896038, rs372302139, rs1554610668, rs775038513, rs765574129, rs764742792, rs1385347376, rs1554611860, rs1554612145, rs1554612159, rs1554612805, rs1554612806, rs1201521544, rs1554613998, rs371318766, rs1554614024, rs1554614022, rs6471482, rs1554614038, rs1391492794, rs1174949911, rs1554614131, rs1554614157, rs1554614423, rs1554618404, rs1554618413, rs1554618417, rs1554618420, rs1052078370, rs1554619292, rs1554619303, rs1554619498, rs1554619500, rs1554619509, rs1442286151, rs1554619513, rs1554619514, rs765383904, rs200805087, rs1554888858, rs1554888861, rs1023522305, rs1554890513, rs1554888353, rs756324901, rs1554888848, rs757622521, rs1554888978, rs1554889905, rs1028838062, rs762773298, rs141386891, rs1553450762, rs138958917, rs1553450764, rs1553227755, rs745308973, rs1554609943, rs1554614402, rs1554609978, rs1554604775, rs1554607548, rs1558820471, rs1558022158, rs1558811557, rs1557917535, rs748981899, rs1557917899, rs1557918619, rs1557918635, rs1557918911, rs1403825722, rs1557920291, rs146606352, rs1557918544, rs1557918638, rs777878533, rs1558820134, rs1000861056, rs998703203, rs1585942791, rs750257554, rs374258471, rs1571134523, rs778114016, rs763041373, rs1571143590, rs1570562309, rs1574385431, rs1574390600, rs1464167194, rs1574391103, rs781227859, rs770786127, rs1586003680, rs1233466909, rs1586047969, rs766703340, rs1692739030, rs1692898861, rs371558158, rs1823261605, rs1330263985, rs1574390811, rs1692509021, rs749842881, rs1692921014, rs757167624, rs201782746, rs761969118, rs1823778696, rs1692508715, rs761554853, rs1227761587, rs201747279, rs183838250	25739440, 22901948
Cone dystrophy	Cone Dystrophy	rs121918537, rs796051871, rs104893967, rs61750172, rs61750173, rs606231180, rs606231181, rs61755783, rs61749668, rs61753046, rs762426409, rs374805348, rs794727197, rs863224908, rs869320709, rs139027297, rs140451304, rs1238632042, rs117522010, rs1023522305, rs531851447, rs1271498710, rs1554186441, rs757622521, rs1028838062, rs1568725951, rs1564801134, rs1557918619, rs1582323732, rs1589705946, rs1589693002, rs1659954489, rs1660447204, rs1660845802, rs1692799480, rs1800113541, rs138924201, rs748084580, rs1883036406, rs1905007623, rs1589690942, rs1589704707, rs1768016995
Cone monochromatism	Cone monochromatism	rs104894912, rs121434621, rs104894914
Cone-rod dystrophy	Cone-Rod Dystrophies	rs200691042, rs121908281, rs28940314, rs121434337, rs80338903, rs121909398, rs28937883, rs397515360, rs137853006, rs786205085, rs137853040, rs137853041, rs786205086, rs104894671, rs1568626209, rs104894672, rs61748436, rs2123743692, rs61751408, rs61751374, rs61750200, rs62642560, rs61752410, rs121909206, rs387906388, rs61753033, rs61750172, rs61750173, rs267606857, rs606231180, rs606231181, rs137852551, rs863223294, rs61755792, rs61755786, rs62625014, rs781781440, rs137853932, rs1064792853, rs387907136, rs397517974, rs397517994, rs786200944, rs398123044, rs398122960, rs61752435, rs1800728, rs398124354, rs61749679, rs61750184, rs61755781, rs281865373, rs62653029, rs62635009, rs281865297, rs61748558, rs61749409, rs61750202, rs61750065, rs61751398, rs61750146, rs281865377, rs61751388, rs62646861, rs61750158, rs61751403, rs62646872, rs61750575, rs61751407, rs61750645, rs281865516, rs61751266, rs137853907, rs483353055, rs587777469, rs587777470, rs587777471, rs199882533, rs76216585, rs587777693, rs587777694, rs786205151, rs150115958, rs2723341, rs201422368, rs786205664, rs746559651, rs786205665, rs786205661, rs794727197, rs192003551, rs886041039, rs863224913, rs771214648, rs863225090, rs751163782, rs875989778, rs886044750, rs768278935, rs886044735, rs201471607, rs61752398, rs878853400, rs886037880, rs886037881, rs886039559, rs748706582, rs886039882, rs886041900, rs886042153, rs749526785, rs1057516195, rs1057516199, rs543698823, rs199840367, rs752175052, rs1085307121, rs104893793, rs1064797182, rs1131691378, rs778234759, rs1553193813, rs373331232, rs756678484, rs780667159, rs1557110499, rs1553901823, rs201587670, rs1439202144, rs1555635778, rs1429786931, rs1553187160, rs1553188916, rs1555345387, rs61749412, rs951379922, rs1554186472, rs767528365, rs1210104601, rs776289402, rs750740765, rs544616523, rs75459701, rs759940113, rs1557787559, rs782581701, rs771116776, rs1006935198, rs755733328, rs1560141393, rs121918567, rs752263228, rs775957498, rs1030149008, rs530749007, rs141823837, rs1570393848, rs1571250020, rs1570382663, rs78484040, rs766357803, rs1437021651, rs1601982595, rs1597331616, rs748798324, rs759408031, rs747512450, rs373680665, rs1355802816, rs374017889, rs1589307705, rs376500610, rs1598146173, rs1598149154, rs752619497, rs1571257937, rs1572829866, rs1426009756, rs1464167194, rs1588391640, rs1588865728, rs1589306127, rs1420750126, rs1598150539, rs1598150793, rs1601972449, rs782740998, rs767366723, rs1602653110, rs778456901, rs1662213462, rs1662507319, rs751644763, rs1689012192, rs1667508280, rs1719285721, rs1734066547, rs1800111659, rs1827340429, rs1196886096, rs1882924778, rs2046020472, rs2046113301, rs1594280740, rs1590681805, rs1570373408, rs369973540, rs1005271380, rs368213921, rs535922252, rs745741473, rs138370992, rs772656461, rs749738655, rs1968173024, rs746128841, rs1887576038, rs909373397, rs750116711, rs1659840790, rs1768016995, rs1186795749
Retinal cone dystrophy	Retinal Cone Dystrophy 3A	rs200311463	22901948, 25739440

Associations from Text Mining
Disease Name	Relationship Type	References
Color Vision Defects	Associate	22901948, 31237654, 32913385, 34360608, 36980963, 37372476
Cone Dystrophy	Associate	22901948
Leukemia Lymphocytic Chronic B Cell	Associate	8104536
Lymphoma Non Hodgkin	Associate	8104536
Myopia	Associate	36980963
Neoplasms	Inhibit	8104536
Parkinson Disease	Associate	38272954