Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51473
Gene name Gene Name - the full gene name approved by the HGNC.
Doublecortin domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCDC2
Synonyms (NCBI Gene) Gene synonyms aliases
DCDC2A, DFNB66, NPHP19, NSC, RU2, RU2S
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a doublecortin domain-containing family member. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. This family member is thought to function in neuronal migration where it may affect the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41271773 T>C Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs141060456 G>A,T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, synonymous variant
rs142088541 C>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs144695853 A>C Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs145154884 C>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043780 hsa-miR-328-3p CLASH 23622248
MIRT538182 hsa-miR-34c-3p PAR-CLIP 22012620
MIRT538181 hsa-miR-362-5p PAR-CLIP 22012620
MIRT538180 hsa-miR-500b-5p PAR-CLIP 22012620
MIRT538179 hsa-miR-501-5p PAR-CLIP 22012620
Transcription factors
Transcription factor Regulation Reference
EHF Repression 22733135
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration IBA
GO:0001764 Process Neuron migration IEA
GO:0001764 Process Neuron migration ISS
GO:0001764 Process Neuron migration NAS 16278297
GO:0005515 Function Protein binding IPI 21698230, 25416956, 25557784, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605755 18141 ENSG00000146038
Protein
UniProt ID Q9UHG0
Protein name Doublecortin domain-containing protein 2 (Protein RU2S)
Protein function Protein that plays a role in the inhibition of canonical Wnt signaling pathway (PubMed:25557784). May be involved in neuronal migration during development of the cerebral neocortex (By similarity). Involved in the control of ciliogenesis and cil
PDB 2DNF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03607 DCX 35 94 Doublecortin Family
PF03607 DCX 157 215 Doublecortin Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. In brain, highly expressed in the entorhinal cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus (PubMed:10601354, PubMed:16278297). Expressed in liver by cholangiocy
Sequence
MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFG
AVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQEAF
KKLNYLDIGEIKKRPMEVVNTEVKPV
IHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLR
SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKF
KKLPYSELLFDKSTMRRPFGQKASS
LPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS
QETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDA
EQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVN
NELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA
Sequence length 476
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness Autosomal recessive nonsyndromic hearing loss 66 rs794729665 N/A
Isolated Sclerosing Cholangitis isolated neonatal sclerosing cholangitis rs1042640142, rs1050411259, rs904944428, rs1554144869, rs730880299, rs757704417 N/A
Nephronophthisis nephronophthisis 19 rs760040426, rs904520404, rs730880299, rs757704417 N/A
Nonsyndromic Deafness nonsyndromic deafness rs794729665 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer (late onset) N/A N/A GWAS
Senior-Boichis Syndrome Senior-Boichis syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Apraxias Associate 39202429
Articulation Disorders Associate 39202429
Attention Deficit Disorder with Hyperactivity Associate 19362708
Auditory Perceptual Disorders Associate 19362708
Breast Neoplasms Associate 29028086
Carcinoma Hepatocellular Inhibit 24034596
Ciliopathies Associate 35570614
Cognition Disorders Associate 24926531
Cumulative Trauma Disorders Associate 26019324
Death Associate 27469900