Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5146
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphodiesterase 6C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDE6C
Synonyms (NCBI Gene) Gene synonyms aliases	ACHM5, COD4, PDEA2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ACHM5, COD4
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q23.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the alpha-prime subunit of cone phosphodiesterase, which is composed of a homodimer of two alpha-prime subunits and 3 smaller proteins of 11, 13, and 15 kDa. Mutations in this gene are associated with cone dystrophy type 4 (COD4). [provi

Show/Hide all(39)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918537	C>A,T	Pathogenic	Synonymous variant, missense variant, coding sequence variant
rs121918538	T>A	Pathogenic	Missense variant, coding sequence variant
rs121918539	A>G	Pathogenic	Missense variant, coding sequence variant
rs140524715	A>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs181296577	T>C	Conflicting-interpretations-of-pathogenicity	Intron variant
rs267606934	A>G,T	Pathogenic	Coding sequence variant, missense variant
rs267606935	T>A	Pathogenic	Coding sequence variant, stop gained
rs267606936	G>A	Pathogenic	Coding sequence variant, missense variant
rs267606937	C>T	Pathogenic	Coding sequence variant, stop gained
rs374805348	G>A	Likely-pathogenic	Intron variant
rs387906401	G>C	Pathogenic	Coding sequence variant, missense variant
rs756324901	G>T	Pathogenic	Coding sequence variant, stop gained
rs757622521	C>T	Pathogenic	Coding sequence variant, stop gained
rs762152984	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs762426409	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs766703340	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs786200908	->AG	Pathogenic	Coding sequence variant, frameshift variant
rs786200909	T>A	Pathogenic	Intron variant
rs786200910	A>G	Pathogenic	Splice acceptor variant
rs786200911	->A	Pathogenic	Stop gained, coding sequence variant
rs786205462	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs786205463	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs796051871	GTAAG>-	Pathogenic, likely-pathogenic	Coding sequence variant, intron variant, splice donor variant
rs863224908	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1023522305	G>A,C	Likely-pathogenic	Splice donor variant
rs1028838062	C>T	Pathogenic	Stop gained, coding sequence variant
rs1057518244	G>T	Likely-pathogenic	Splice acceptor variant
rs1554888353	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554888848	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554888858	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1554888861	G>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1554888978	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554889905	G>A	Pathogenic	Splice donor variant
rs1554890513	AAGT>-	Likely-pathogenic	Intron variant, coding sequence variant, splice donor variant
rs1564801134	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1589690942	G>A	Pathogenic	Coding sequence variant, stop gained
rs1589693002	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1589704707	T>G	Pathogenic	Splice donor variant
rs1589705946	G>A	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007601	Process	Visual perception	IBA	21873635
GO:0007603	Process	Phototransduction, visible light	IEA
GO:0030553	Function	CGMP binding	IEA
GO:0046549	Process	Retinal cone cell development	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IEA

MIM	HGNC	e!Ensembl
600827	8787	ENSG00000095464

Protein

UniProt ID

P51160

Protein name

Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' (EC 3.1.4.35) (cGMP phosphodiesterase 6C)

Protein function

As cone-specific cGMP phosphodiesterase, it plays an essential role in light detection and cone phototransduction by rapidly decreasing intracellular levels of cGMP.

PDB

3JWQ , 3JWR , 5E8F , 9CXG , 9CXH , 9CXI , 9CXJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01590	GAF	75 → 224	GAF domain	Domain
PF01590	GAF	256 → 433	GAF domain	Domain
PF00233	PDEase_I	561 → 806		Domain

Sequence

MGEINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSIILRLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRSYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKA
AEDSGGGDDKKSKTCLML

Sequence length

858

Interactions

View interactions

	KEGG
	Purine metabolism Metabolic pathways

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Achromatopsia	Achromatopsia, Achromatopsia 5	rs121918344, rs267606739, rs397515360, rs121918537, rs121918538, rs786200908, rs796051871, rs121918539, rs387906401, rs267606936, rs786200909, rs786200910, rs267606934, rs267606937, rs267606935 View all (196 more)	19615668
Cone dystrophy	CONE DYSTROPHY 4 (disorder), Progressive cone dystrophy	rs121918537, rs796051871, rs104893967, rs61750172, rs61750173, rs606231180, rs606231181, rs61755783, rs61749668, rs61753046, rs762426409, rs374805348, rs794727197, rs863224908, rs869320709 View all (28 more)	19615668, 28583373, 21127010
Cone monochromatism	Cone monochromatism	rs104894912, rs121434621, rs104894914
Cone-rod dystrophy	Cone-Rod Dystrophies	rs200691042, rs121908281, rs28940314, rs121434337, rs80338903, rs121909398, rs28937883, rs397515360, rs137853006, rs786205085, rs137853040, rs137853041, rs786205086, rs104894671, rs1568626209 View all (207 more)
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Progressive cone dystrophy	Progressive cone dystrophy (without rod involvement)	rs61750173, rs61755783, rs764759172, rs1557106557, rs1306231185, rs536742386, rs1402837406, rs781339303	19615668

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Cone Dystrophy	cone dystrophy 4, cone dystrophy	GenCC
Retinal Dystrophy	inherited retinal dystrophy	GenCC

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining
Achromatopsia incomplete X linked	Associate	31520890
beta Thalassemia	Associate	11074564
Color Vision Defects	Associate	19615668, 22901948, 24148654, 29618791, 30080950, 31237654, 31520890, 31826238, 32306724, 32913385, 33001157, 34360608, 36833446, 36835061, 36980963, 37372476 View all (1 more)
Cone Dystrophy	Associate	19615668, 33001157, 37433860
Cone Rod Dystrophies	Associate	23776498, 33001157
Jet Lag Syndrome	Associate	31826238
Myopia	Associate	31826238, 36980963
Night Blindness	Associate	33001157
Nystagmus Pathologic	Associate	31826238, 33001157
Parkinson Disease	Associate	40240887
Polyendocrinopathies Autoimmune	Associate	37433860
Prostatic Neoplasms	Associate	25979379
Retinal Cone Dystrophy 1	Associate	30080950
Retinal Dystrophies	Associate	37165311
Retinitis	Associate	31826238, 32306724
Retinitis Pigmentosa	Associate	37165311
RHYNS syndrome	Associate	37165311
Usher Syndromes	Associate	37165311
Vision Disorders	Associate	31520890, 36980963

PDE6C (phosphodiesterase 6C)