Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51441
Gene name Gene Name - the full gene name approved by the HGNC.
YTH N6-methyladenosine RNA binding protein F2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YTHDF2
Synonyms (NCBI Gene) Gene synonyms aliases
CAHL, DF2, HGRG8, NY-REN-2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p35.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and ma
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023842 hsa-miR-1-3p Proteomics 18668040
MIRT044257 hsa-miR-106b-5p CLASH 23622248
MIRT040054 hsa-miR-615-3p CLASH 23622248
MIRT734028 hsa-miR-495-3p Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting 33087165
MIRT734028 hsa-miR-495-3p Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting 33087165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 24284625, 31292544, 32492408
GO:0000932 Component P-body IEA
GO:0001556 Process Oocyte maturation IEA
GO:0001556 Process Oocyte maturation ISS
GO:0002376 Process Immune system process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610640 31675 ENSG00000198492
Protein
UniProt ID Q9Y5A9
Protein name YTH domain-containing family protein 2 (DF2) (CLL-associated antigen KW-14) (High-glucose-regulated protein 8) (Renal carcinoma antigen NY-REN-2)
Protein function Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates their stability (PubMed:24284625, PubMed:26046440, PubMed:26318451, PubMed:32492408). M6A is a modification present at internal sites of mRNAs and some non
PDB 4RDN , 4RDO , 4WQN , 7A1V , 7BIK , 7R5F , 7R5L , 7R5W , 7YWB , 7YX6 , 7YXE , 7Z26 , 7Z4U , 7Z54 , 7Z5M , 7Z7B , 7Z7F , 7Z8P , 7Z8W , 7Z8X , 7Z92 , 7Z93 , 7ZG4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04146 YTH 410 545 YT521-B-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in induced pluripotent stem cells (iPSCs) and down-regulated during neural differentiation. {ECO:0000269|PubMed:32169943}.
Sequence
MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIA
SYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Sequence length 579
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36133437
Adenocarcinoma of Lung Stimulate 32086933
Adenocarcinoma of Lung Associate 32398949, 34497675, 35730068, 36397411
Adenomyosis Associate 35512522
Arthritis Rheumatoid Associate 32884942
Arthritis Rheumatoid Inhibit 35776431
Breast Neoplasms Associate 36216883, 36609396, 37499929
Carcinogenesis Associate 32126149, 32948220, 33411363, 33726814, 35512522, 35730068, 37515378
Carcinogenesis Stimulate 36609396
Carcinoma Endometrioid Associate 33692441