Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51441
Gene name Gene Name - the full gene name approved by the HGNC.	YTH N6-methyladenosine RNA binding protein F2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	YTHDF2
Synonyms (NCBI Gene) Gene synonyms aliases	CAHL, DF2, HGRG8, NY-REN-2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and ma

Show/Hide all(131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023842	hsa-miR-1-3p	Proteomics	18668040
MIRT044257	hsa-miR-106b-5p	CLASH	23622248
MIRT040054	hsa-miR-615-3p	CLASH	23622248
MIRT734028	hsa-miR-495-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33087165
MIRT734028	hsa-miR-495-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting	33087165
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT1499901	hsa-miR-130a	CLIP-seq
MIRT1499902	hsa-miR-130b	CLIP-seq
MIRT1499903	hsa-miR-19a	CLIP-seq
MIRT1499904	hsa-miR-19b	CLIP-seq
MIRT1499905	hsa-miR-2113	CLIP-seq
MIRT1499906	hsa-miR-2117	CLIP-seq
MIRT1499907	hsa-miR-2276	CLIP-seq
MIRT1499908	hsa-miR-301a	CLIP-seq
MIRT1499909	hsa-miR-301b	CLIP-seq
MIRT1499910	hsa-miR-3201	CLIP-seq
MIRT1499911	hsa-miR-323b-3p	CLIP-seq
MIRT1499912	hsa-miR-3611	CLIP-seq
MIRT1499913	hsa-miR-3666	CLIP-seq
MIRT1499914	hsa-miR-3689a-3p	CLIP-seq
MIRT1499915	hsa-miR-3689c	CLIP-seq
MIRT1499916	hsa-miR-3691-3p	CLIP-seq
MIRT1499917	hsa-miR-4255	CLIP-seq
MIRT1499918	hsa-miR-4273	CLIP-seq
MIRT1499919	hsa-miR-4295	CLIP-seq
MIRT1499920	hsa-miR-454	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499922	hsa-miR-4728-5p	CLIP-seq
MIRT1499923	hsa-miR-4791	CLIP-seq
MIRT1499924	hsa-miR-511	CLIP-seq
MIRT1499925	hsa-miR-515-5p	CLIP-seq
MIRT1499926	hsa-miR-519a	CLIP-seq
MIRT1499927	hsa-miR-519b-3p	CLIP-seq
MIRT1499928	hsa-miR-519c-3p	CLIP-seq
MIRT1499929	hsa-miR-548g	CLIP-seq
MIRT1499930	hsa-miR-651	CLIP-seq
MIRT1499931	hsa-miR-654-3p	CLIP-seq
MIRT1499932	hsa-miR-758	CLIP-seq
MIRT1499933	hsa-miR-765	CLIP-seq
MIRT1499934	hsa-miR-1179	CLIP-seq
MIRT1499935	hsa-miR-3194-3p	CLIP-seq
MIRT1499936	hsa-miR-3613-3p	CLIP-seq
MIRT1499937	hsa-miR-4475	CLIP-seq
MIRT1499938	hsa-miR-4766-5p	CLIP-seq
MIRT1499939	hsa-miR-101	CLIP-seq
MIRT1499940	hsa-miR-1236	CLIP-seq
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT1499941	hsa-miR-1260	CLIP-seq
MIRT1499942	hsa-miR-1260b	CLIP-seq
MIRT1499943	hsa-miR-1278	CLIP-seq
MIRT1499944	hsa-miR-144	CLIP-seq
MIRT1499945	hsa-miR-181a	CLIP-seq
MIRT1499946	hsa-miR-181b	CLIP-seq
MIRT1499947	hsa-miR-181c	CLIP-seq
MIRT1499948	hsa-miR-181d	CLIP-seq
MIRT1499949	hsa-miR-188-3p	CLIP-seq
MIRT1499950	hsa-miR-30a	CLIP-seq
MIRT1499951	hsa-miR-30b	CLIP-seq
MIRT1499952	hsa-miR-30c	CLIP-seq
MIRT1499953	hsa-miR-30d	CLIP-seq
MIRT1499954	hsa-miR-30e	CLIP-seq
MIRT1499955	hsa-miR-3117-3p	CLIP-seq
MIRT1499956	hsa-miR-3124-3p	CLIP-seq
MIRT1499957	hsa-miR-3156-3p	CLIP-seq
MIRT1499958	hsa-miR-3165	CLIP-seq
MIRT1499959	hsa-miR-3169	CLIP-seq
MIRT1499960	hsa-miR-3185	CLIP-seq
MIRT1499910	hsa-miR-3201	CLIP-seq
MIRT1499961	hsa-miR-342-5p	CLIP-seq
MIRT1499962	hsa-miR-3607-3p	CLIP-seq
MIRT1499963	hsa-miR-365	CLIP-seq
MIRT1499964	hsa-miR-3686	CLIP-seq
MIRT1499965	hsa-miR-3691-5p	CLIP-seq
MIRT1499966	hsa-miR-4262	CLIP-seq
MIRT1499967	hsa-miR-4301	CLIP-seq
MIRT1499968	hsa-miR-4314	CLIP-seq
MIRT1499969	hsa-miR-4651	CLIP-seq
MIRT1499970	hsa-miR-4652-3p	CLIP-seq
MIRT1499971	hsa-miR-4664-5p	CLIP-seq
MIRT1499972	hsa-miR-4667-5p	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499973	hsa-miR-4700-5p	CLIP-seq
MIRT1499974	hsa-miR-4753-3p	CLIP-seq
MIRT1499975	hsa-miR-4759	CLIP-seq
MIRT1499976	hsa-miR-4768-5p	CLIP-seq
MIRT1499977	hsa-miR-4773	CLIP-seq
MIRT1499923	hsa-miR-4791	CLIP-seq
MIRT1499978	hsa-miR-494	CLIP-seq
MIRT1499979	hsa-miR-495	CLIP-seq
MIRT1499980	hsa-miR-543	CLIP-seq
MIRT1499981	hsa-miR-582-5p	CLIP-seq
MIRT1499982	hsa-miR-586	CLIP-seq
MIRT1499983	hsa-miR-608	CLIP-seq
MIRT1499984	hsa-miR-637	CLIP-seq
MIRT1499985	hsa-miR-647	CLIP-seq
MIRT1499930	hsa-miR-651	CLIP-seq
MIRT1499986	hsa-miR-802	CLIP-seq
MIRT1499987	hsa-miR-938	CLIP-seq
MIRT1499900	hsa-miR-1238	CLIP-seq
MIRT2150504	hsa-miR-145	CLIP-seq
MIRT2150505	hsa-miR-3180-5p	CLIP-seq
MIRT2150506	hsa-miR-579	CLIP-seq
MIRT1499901	hsa-miR-130a	CLIP-seq
MIRT1499902	hsa-miR-130b	CLIP-seq
MIRT1499903	hsa-miR-19a	CLIP-seq
MIRT1499904	hsa-miR-19b	CLIP-seq
MIRT1499906	hsa-miR-2117	CLIP-seq
MIRT1499908	hsa-miR-301a	CLIP-seq
MIRT1499909	hsa-miR-301b	CLIP-seq
MIRT1499913	hsa-miR-3666	CLIP-seq
MIRT1499916	hsa-miR-3691-3p	CLIP-seq
MIRT1499917	hsa-miR-4255	CLIP-seq
MIRT1499918	hsa-miR-4273	CLIP-seq
MIRT1499919	hsa-miR-4295	CLIP-seq
MIRT1499920	hsa-miR-454	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT1499925	hsa-miR-515-5p	CLIP-seq
MIRT1499926	hsa-miR-519a	CLIP-seq
MIRT1499927	hsa-miR-519b-3p	CLIP-seq
MIRT1499928	hsa-miR-519c-3p	CLIP-seq
MIRT1499944	hsa-miR-144	CLIP-seq
MIRT1499921	hsa-miR-4698	CLIP-seq
MIRT2463736	hsa-miR-129-5p	CLIP-seq
MIRT2463736	hsa-miR-129-5p	CLIP-seq
MIRT2664521	hsa-miR-629	CLIP-seq
MIRT1499907	hsa-miR-2276	CLIP-seq
MIRT2695440	hsa-miR-3921	CLIP-seq
MIRT2695441	hsa-miR-4653-5p	CLIP-seq
MIRT2695442	hsa-miR-4772-3p	CLIP-seq
MIRT1499929	hsa-miR-548g	CLIP-seq
MIRT2695443	hsa-miR-593	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	24284625
GO:0001556	Process	Oocyte maturation	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003729	Function	MRNA binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	24965446, 28106072, 30930054
GO:0005634	Component	Nucleus	IDA	26458103
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA	26458103
GO:0006402	Process	MRNA catabolic process	IDA	27558897, 30559377, 30930054
GO:0006959	Process	Humoral immune response	TAS	10508479
GO:0016032	Process	Viral process	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0043488	Process	Regulation of mRNA stability	IMP	24284625, 26046440
GO:0045087	Process	Innate immune response	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	ISS
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	30559377
GO:0061157	Process	MRNA destabilization	IBA	21873635
GO:0061157	Process	MRNA destabilization	IDA	27558897, 30559377, 30930054
GO:0061157	Process	MRNA destabilization	IMP	28106072
GO:0071425	Process	Hematopoietic stem cell proliferation	ISS
GO:0098508	Process	Endothelial to hematopoietic transition	ISS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	ISS
GO:1903538	Process	Regulation of meiotic cell cycle process involved in oocyte maturation	ISS
GO:1903679	Process	Positive regulation of cap-independent translational initiation	IDA	26458103
GO:1990247	Function	N6-methyladenosine-containing RNA binding	IBA	21873635
GO:1990247	Function	N6-methyladenosine-containing RNA binding	IDA	22575960, 24284625, 25412658, 25412661, 26046440, 26318451, 26458103, 27558897, 28106072, 30559377, 30930054

MIM	HGNC	e!Ensembl
610640	31675	ENSG00000198492

Protein

UniProt ID

Q9Y5A9

Protein name

YTH domain-containing family protein 2 (DF2) (CLL-associated antigen KW-14) (High-glucose-regulated protein 8) (Renal carcinoma antigen NY-REN-2)

Protein function

Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates their stability (PubMed:24284625, PubMed:26046440, PubMed:26318451, PubMed:32492408). M6A is a modification present at internal sites of mRNAs and some non

PDB

4RDN , 4RDO , 4WQN , 7A1V , 7BIK , 7R5F , 7R5L , 7R5W , 7YWB , 7YX6 , 7YXE , 7Z26 , 7Z4U , 7Z54 , 7Z5M , 7Z7B , 7Z7F , 7Z8P , 7Z8W , 7Z8X , 7Z92 , 7Z93 , 7ZG4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04146	YTH	410 → 545	YT521-B-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in induced pluripotent stem cells (iPSCs) and down-regulated during neural differentiation. {ECO:0000269|PubMed:32169943}.

Sequence

MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

Sequence length

579

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (67)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	36133437
Adenocarcinoma of Lung	Stimulate	32086933
Adenocarcinoma of Lung	Associate	32398949, 34497675, 35730068, 36397411
Adenomyosis	Associate	35512522
Arthritis Rheumatoid	Associate	32884942
Arthritis Rheumatoid	Inhibit	35776431
Breast Neoplasms	Associate	36216883, 36609396, 37499929
Carcinogenesis	Associate	32126149, 32948220, 33411363, 33726814, 35512522, 35730068, 37515378
Carcinogenesis	Stimulate	36609396
Carcinoma Endometrioid	Associate	33692441
Carcinoma Endometrioid	Stimulate	35512522
Carcinoma Hepatocellular	Associate	28104805, 32111180, 32631107, 32733931, 34234878, 34609072, 34647424, 34747720, 35833147, 36339682, 37833468
Carcinoma Hepatocellular	Stimulate	34221187, 37515378
Carcinoma Non Small Cell Lung	Associate	34408926, 35924072, 37919739
Carcinoma Ovarian Epithelial	Stimulate	32948220
Carcinoma Renal Cell	Associate	35840930, 38164857
Cardiomegaly	Associate	37315764
Cerebral Hemorrhage	Associate	37907028
Cholangiocarcinoma	Associate	35094011, 35696608
Colorectal Neoplasms	Associate	33411363, 33415160, 37194014, 37203239, 37264959, 37381158
Crohn Disease	Associate	36595818
Diabetes Mellitus	Associate	36333113
Diabetes Mellitus Type 2	Associate	36891946
Endometrial Hyperplasia	Associate	35512522
Endometrial Neoplasms	Associate	34347888, 34889221, 35512522
Endometriosis	Associate	36675186
Esophageal Squamous Cell Carcinoma	Associate	34054840
Eye Diseases	Associate	35139773
Fever	Associate	32583611, 36072379
Fibrosis	Inhibit	37315764
Glioblastoma	Associate	33023892
Glioma	Associate	34432221, 35661004, 36123877
Hypoproteinemia	Associate	36072379
Hypoxia	Associate	34609072, 35499052
Inert Gas Narcosis	Associate	35512522
Inflammation	Associate	34375639, 35776431
Insulin Resistance	Associate	37730054
Iron Overload	Associate	37315764
Leukemia	Associate	37386016
Lung Neoplasms	Associate	34408926
Lupus Erythematosus Systemic	Inhibit	32583611, 32685056
Lupus Erythematosus Systemic	Associate	35120571
Lymphoma Non Hodgkin	Stimulate	35661004
Melanoma	Associate	33726814
Multiple Myeloma	Associate	37012388
Myopia	Associate	38190128
Neoplasm Invasiveness	Associate	35512522
Neoplasm Metastasis	Associate	35924072, 36216883
Neoplasms	Associate	28104805, 32126149, 32631107, 34158539, 34408926, 35047056, 35512522, 35661004, 36397411, 36658237, 36973285, 37012388, 37831104
Osteoarthritis	Associate	37006311
Osteoporosis	Associate	36034449
Osteosarcoma	Associate	35490460
Ovarian Neoplasms	Associate	32948220
Pancreatic Neoplasms	Associate	29135329, 35422475, 35609514, 37149664, 37923686
Parkinson Disease	Associate	37309980
Periodontitis	Associate	36133437
Prostatic Neoplasms	Associate	36133437, 37831104
Sarcoma Ewing	Associate	35487915
Sarcoma Kaposi	Associate	29659627
Scleral Diseases	Associate	38190128
Squamous Cell Carcinoma of Head and Neck	Associate	34207099
Stomach Neoplasms	Associate	35499052
Tuberculosis Pulmonary	Associate	36072379
Urinary Bladder Neoplasms	Associate	32126149
Uterine Cervical Dysplasia	Associate	35512522
Uterine Cervical Neoplasms	Associate	36028854, 37273106
Ventricular Remodeling	Associate	37315764

YTHDF2 (YTH N6-methyladenosine RNA binding protein F2)